IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. 14-Nov-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. 14-Nov-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro protease assay protease assay predetermined predetermined participant predetermined Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. 14-Nov-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. 14-Nov-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. 14-Nov-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Robust stability of the embryonic axial pattern requires a secreted scaffold for chordin degradation. Cell (0092-8674) 2008 imex curation Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp 14-Nov-2008: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Inomata H., Haraguchi T., Sasai Y. Only sequence for ONT1 is 1 aa shorter than given in the paper however, the sequence described by the authors is working its way from EMBL to TrEMBL. I've asked Becky to annotate it into SP so coordinatess are corrected rather than put an error message on the entry. HEK293T cells were transfected separately with each plasmid expression vector. Conditioned media-containing proteins were immunoprecipitated using anti-Flag M2 affinity gel, the anti-Flag M2 affinity gel was then incubated with conditioned medium containing prey protein. yoshikisasai@cdb.riken.jp Accepted 2008-NOV-2 by DAVET. 14-Nov-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 14 imex curation bmp4_human Bone morphogenetic protein 4 BMP4 BMP2B DVR4 Bone morphogenetic protein 2B protein protein human Homo sapiens Human MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR DIP protein P12644 original sequence version: 157 79B01179DBB98204 tll1_xenla Tolloid-like protein 1 tll1 xlr Xenopus tolloid-like protein 1 Metalloprotease xolloid-like Xlr protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MNMPSWLIFLLTGWTFCGNFFACGGLDYDYPNYENEEEKNEAIDYKDPCKAVVFWGDIALDEEDLKMFHIDRTIDLTQHSNEKLGHTTGGLEEHDLSKKRGALYQLIERIRRFGSGQENTTANSQKVDNNQSGKSKKIRIPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIERTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVHSLGESYDFDSIMHYARNTFSRGMFLDTILPSRDENGLRPPIGQRTRLSKGDIAQARKLYRCPACGETLQESTGNFSSPGFPNGYPSYTHCIWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWKKSPLLGRFCGDKLPDVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIHKDAGQIQSPNYPDDYRPLKECVWKITVAENYNVGLTFQAFEIERHDNCAYDYLEVRDGSSENSPLIGHFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFLKEEDECARPDNGGCEQRCVNTLGSYKCSCDPGYELAPDKKSCEAACGGLLTKLNGTITTPAWPKEYPPNKNCVWQVVAPSQYRISMKFDYFELEGNEVCKYDYVEVRSGLSSDSKLHGKFCGTEVPEVITSQFNNMRIEFKSDNTVSKKGFRAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFVLHDNKHDCKEAECEHRIHSSNGVITSPNWPDKYPSRKECTWEISATPGHRVKLSFSEFEIEQHQECAYDHLEVFDGETEKSSILGRLCGSKVPEPLVATGNEMFIRFVSDASVQRKGFQATHSTECGGRLKAEAKPRDLFSHAQFGDNNYPVQADCEWILMTERGLRIELNFQTFEVEEEADCGYDFMELFDGHDASAMRLGRFCGSGPPEEIVSTGDAVLIHFHTDDTISKKGFHIRYRSVKYQDILHTK 3F33C686A7EF230C bmp1_xenla Bone morphogenetic protein 1 bmp1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDYSYDLEEVVEETIDYKDPCKAAAFWGDIALDEEDLANFKIDRIVDLTKHTIHTVSGAATNISRPEKGRRTRKERRRSREKRASTSRPERVWPDGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFLERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVSIIRENIQPGQEYNFLKMEPEEVESLGETYDFDSIMHYARNTFSRGIFLDTILPKYDVNGVRPPIGQRTRLSSGDVAQARKLYKCPACGETLQDSQGNFSSPGFPNGYSAYMHCVWRLSVTPGEKIILNFTSLDLYRSRLCWYDYIEVRDGFWKKAPLRGRFCGDKIPESIISTESRLWIEFRSSSNWVGKGFQAVYEALCGGEVKKDSGHIQSPNYPDDYRPNKACVWKLSVSEGFHVGISFQSFEIERHDSCAYDYLEIRDGSSETSPLVGRFCGYDKPDDIKSSTNQLWIKFVSDGSINKAGFSLNYFKEVDECSRPNNGGCEQRCVNTLGSYKCACDPGYELGQDKKSCEAACGGFLTKLNGSINSPGWPKEYPPNKNCIWQLVAPTQYRISLKFDQFETEGNDVCKYDFVEVRSGLTSDSKLHGKFCGSELPAVITSQYNNMRIEFKSDNTVSKKGFQANFFSEKKNNIQKLQQLNEVNRGQQNQAPKRVRPRMRLRTVKKTRPP 1B6980D716DC9B8D q91597_xenla admp.S LOC398053 admp XELAEV_18009898mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDLRKMLGFIFLFFIIQECTSRPTDMVDSTDLELEDPELVRAEALKRLLEVFGIEEPPQPLQHVKQPPQYMVDLYNTVADEDGVTKDPDLLEGNTVRSFFDKIHSDHMHFLFNLWTVARNEKILTAELHLFKLKPRPSEQAYFKRHHFCQISVYMVLDKNKIQLPQGRKLLSSKLVPIHSSGWEVFSITQAVRAWNDESANHGILVTVRNLGGAQVDPNIIRFASGRDHHESKQPMLVLFTDDGRRGIVSVNNQPDDQLMPLPNVPMAPTSNRTRLGRSVEEDGQLPCQRHPLYVDFEEIGWSGWIISPRGYNAYHCKGSCPFPLGQNMRPTNHATVQSIINALKLTKGVSSPCCVPDKLFSINLLYFDDDENVVLKQYDDMVAGSCGCH DECB1A001349C895 chrd_xenla Chordin chrd Organizer-specific secreted-dorsalizing factor protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MQCPPILLVWTLWIMAVDCSRPKVFLPIQPEQEPLQSKTPAGCTFGGKFYSLEDSWHPDLGEPFGVMHCVLCYCEPQRSRRGKPSGKVSCKNIKHDCPSPSCANPILLPLHCCKTCPKAPPPPIKKSDFVFDGFEYFQEKDDDLYNDRSYLSSDDVAVEESRSEYVALLTAPSHVWPPVTSGVAKARFNLQRSNLLFSITYKWIDRLSRIRFSDLDGSVLFEHPVHRMGSPRDDTICGIWRSLNRSTLRLLRMGHILVSLVTTTLSEPEISGKIVKHKALFSESFSALLTPEDSDETGGGGLAMLTLSDVDDNLHFILMLRGLSGEEGDQIPILVQISHQNHVIRELYANISAQEQDFAEVLPDLSSREMLWLAQGQLEISVQTEGRRPQSMSGIITVRKSCDTLQSVLSGGDALNPTKTGAVGSASITLHENGTLEYQIQIAGTMSTVTAVTLETKPRRKTKRNILHDMSKDYHDGRVWGYWIDANARDLHMLLQSELFLNVATKDFQEGELRGQITPLLYSGLWARYEKLPVPLAGQFVSPPIRTGSAGHAWVSLDEHCHLHYQIVVTGLGKAEDAALNAHLHGFAELGEVGESSPGHKRLLKGFYGSEAQGSVKDLDLELLGHLSRGTAFIQVSTKLNPRGEIRGQIHIPNSCESGGVSLTPEEPEYEYEIYEEGRQRDPDDLRKDPRACSFEGQLRAHGSRWAPDYDRKCSVCSCQKRTVICDPIVCPPLNCSQPVHLPDQCCPVCEEKKEMREVKKPERARTSEGCFFDGDRSWKAAGTRWHPFVPPFGLIKCAICTCKGSTGEVHCEKVTCPKLSCTNPIRANPSDCCKQCPVEERSPMELADSMQSDGAGSCRFGRHWYPNHERWHPTVPPFGEMKCVTCTCAEGITQCRRQECTGTTCGTGSKRDRCCTKCKDANQDEDEKVKSDETRTPWSF 7D1C3262064C7323 olfl3_xenla Olfactomedin-like protein 3 olfml3 ont1 Olfactomedin-noelin-tiarin factor 1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MMAGIVACILLVFVTVITAQPQAVFLEYIQGRMGVLEERIAQWHDQSSRFSGELRDFKNQVLKMLENIEKERDSLRNEMENTNVRVNRLEREVDYIETQNPAPPCVEIDEKLSDHHGAKKKKKEKYQKITDCSDTISQVTAMKILKRFGSSAGLWTKDLAGNSDRIYVFDGAGNDTVYMYPRMKEFTLSSPTRKAAKIRLPFPWIGTGHIVYDGNLYYIRQDNEFQVIKFSLANKTIIDSAVLPIEQQVPVYGLSKFNYIDIVADEEGLWVIYATKENEKNICLAKLDPSSLSIEQMWDTPCPIENAESAFVVCGSLYVVYNTKLPSRSRIQCVFDVSGTISSENVPIVYFPKRYGSHSSMKYNPREKQIYAWDDGYQIIYKLNMKHRDELY 14466FFBBD41A7A8 ont1-chrd-1 4 12 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range olf region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association In contrast, ONT1 protein was efficiently coimmunoprecipitated with Chordin in vitro Fig. 2A ont1-bmp1-1 4 10 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range coiled coil region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association ONT1 binds to B1TP via its CC domain. Fig. 2B, Supp. Fig. 9B Interaction appears to be inhibited by Szl (O73821) possibly by competing with BMP1 for binding to ONT1 ont1-tll1-1 7 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range coiled coil region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association The interaction of Xlr and ONT1 was analyzed with an anti-myc antibody (C Fig. 2C Coordinates of ONT1 region not given in paper so have been inferredf from the UniProt sequence ont1-chrd-2 1 12 unspecified role unspecified role prey prey xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. 13 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association Fig. 2E ont1-bmp1-2 1 10 unspecified role unspecified role prey prey xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. 13 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. physical association physical association Fig. 2F chrd-tll1-1 3 12 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. protein cleavage protein cleavage Fig. 4E chrd-tll1-2 3 12 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 stimulator stimulator unspecified role unspecified role c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 enzyme enzyme unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. protein cleavage protein cleavage Sup. Fig. 4E At low concentration, ONT1 stimulates TLL1 activity, at higher concentrations it acts as an inhibitor. When a low molecular weight substrate was used in place of chordin, ONT1 had no effect on enzyme rate. ont1-bmp1-3 5 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98070:p.Tyr253Asn mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y N Wed May 02 19:38:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr253asn' Tue Jun 30 16:37:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr253Asn' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Immunoprecipitation assays of dnBMP1 (using a Flag antibody) showed that the association of dnBMP1 and Chordin substantially increased when a small amount of ONT1 was present Fig. 4I ont1-4 2 13 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Homodimerisation identified by molecular weight under non-reducing conditions Supp. Fig. 1B ont1-5 6 13 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Homodimerisation identified by molecular weight under non-reducing conditions Supp. Fig. 1B bmp4-chrd-1 4 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Supp. Fig. 3A admp-chrd-1 4 12 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 3B ont1-chrd-3 4 12 unspecified role unspecified role prey prey cr 2-4 domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-1998282]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 942-942, sequence length 941 [EBI-1998282]693-942 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait c-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Chordin interacts with ONT1 via its CR2-4 domain Fig. 2A ont1-bmp4-1 5 12 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 8 unspecified role unspecified role prey prey human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 13 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association ONT1 binds to the Chordin-BMP4 complex. Supp. Fig. 4C