IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Whole proteome identification of plant candidate G-protein coupled receptors in Arabidopsis, Rice, and Poplar: computational prediction and in vivo protein coupling. Whole proteome identification of plant candidate G-protein coupled receptors in Arabidopsis, Rice, and Poplar: computational prediction and in vivo protein coupling. Genome Biol. (1465-6906) 2008 Gookin TE., Kim J., Assmann SM. sma3@psu.edu 16-Dec-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast ub reconstruction ubiquitin reconstruction ub reconstruction predetermined predetermined participant predetermined Gookin TE., Kim J., Assmann SM. sma3@psu.edu Accepted 2008-Not a month!-10 by ORCHARD. 16-Dec-2008: Contacted by JYOTI. Genome Biol. (1465-6906) 2008 orchard hhp2_arath Heptahelical transmembrane protein 2 HHP2 PAQR family protein HHP2 F6I18.240 At4g30850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQKRRTVKESTKIRNGKGMDSGEKKRSEKRLMKFEELPRYLKDNEFIHNHYRCEWSIKETFLSAFSWHNETLNIWTHLCGFAIFTWMMVVSSMETTELGLAGFVSLLSGATIRWPWPSMAMSKDVYFSSDQTLHHDLNVTHTRSLLNSQGDVNYEAIPKWPWLVFLTGAMGCLICSSMSHLFACHSRRFNLFFWRLDYAGISLMIVCSFFAPIYYAFSCHTYWRLFYLSSISILGLLAIFTLLSPSLSAPRFRSFRAALFLTMGFSGVIPATHVLYLHKDHPNVLIALVYELAMAVLYATGAAFYVTRIPERWKPGAFDIAGHSHQIFHVFVVLGALAHSVASLLIMDFRRASPSCAF 9F57E7AD57D3AFC1 cand8_arath Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 8 CAND8 T21B4.120 At5g27210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRVLDEIAESPFLISPLNPNSTANGYRWVDKCHGFLHNTVLVAASLFFVAYLAYEAKKSLSKLSNRRSYIMIAYYGCLWLVSLLNLAWCCLQGWECTPGKEVVWNLLTLFTTSGMLFLEVSLVAFLFQGNYASGAEALTRTFLISGFIVALDLLLKAIFLFGFGVPLFIDNNENGKTFKWGLWIIHKLLLTGVYGMVFLMYNSRWREKLPARPAFYNYIIIMFALYSLYLVASAFTANNAHFGFWLYGIMSVCYHALYLPLLYITFLADFFQEEDLNLENVYYSEMKDAGFFDSDWE 9ED6AFA991F4B4B3 q945q2_arath At3g59090 Cand3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKILATLFESTKDKCYAPSFIAVNLCLAFIDAALAFIAFLQLSRFHRRNKQVGWTRQKVLHLMIASSNTGSVIYFVAAVIATCTRWHHWSNALGFLLMAFPKILFLATFLLLLSFWVDVCHQGNGEEDDDDDEENSIQQVLLEKSKSKPGSSNASDRRKCCSFHGIHVGTRQKFVVAAIILVFILMISFAILIWIASGKNPMNSSLLAEVYVDIFAAIILITGGGICFYGLRLLFNLRKVRSEQVSSEMRKVSGLAGVSVVCFTVSSLIALLTHIPLFYHWNPSKLHGIKALVLLIIYYFIGSTVPLAFVLWVLRELPPQNIVSRQEDTRRITYVNYETVPRQPQGPQQDWASATVSKNQLPGKSLVGLQNGS 962BC04B2BA742B0 cand2_arath Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 2 CAND2 PMTR1 Protein PHYTOMELATONIN RECEPTOR 1 T9J14.4 At3g05010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRVLSEIAESPFVISRLSPDSTATGGFIGGWVGKCHGFLHNTVLVLASILFVAYLAYEAKKSLSKLSNRRSYIMIAYYGFLWLVSLLNLAWCCLQAWECTPGKEVIWNLLTLFTTSGMLFLEVSLVAFLFQGNYASGAEALTRTFLISGLVIGLDLLLKAIYLFGFGVPLFIDNNEHIHKFKWGLWVIHKLLLAGIYGMIFFMYNSKWRERLPARPAFYKYITVMLALNGLSLFACALTANGAHFGLWLYGITSVCYHAFYLPLLYVTFLADFFQEEDLNLENVYYSEMKDAGFFDADWE 4975BA386A438569 b9dga1_arath Cand3 At3g59090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLLASSPSISVWLLSMPLLLSSHSFRFILAAYFFQLSRFHRRNKQVGWTRQKVLHLMIASSNTGSVIYFVAAVIATCTRWHHWSNALGFLLMAFPKILFLATFLLLLSFWVDVCHQGNGEEDDDDDEENSIQQVLLEKSKSKPGSSNASDRRKCCSFHGIHVGTRQKFVVAAIILVFILMISFAILIWIASGKNPMNSSLLAEVYVDIFAAIILITGGGICFYGLRLLFNLRKVRSEQVSSEMRKVSGLAGVSVVCFTVSSLIALLTHIPLFYHWNPSKLHGIKALVLLIIYYFIGSTVPLAFVLWVLRELPPQNIVSRQEDTRRITYVNYETVPRQPQGPQQDWASATVSKNQVSKASPI 042A0E9957345DC0 gpa1_arath Guanine nucleotide-binding protein alpha-1 subunit GPA1 At2g26300 T1D16.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGLLCSRSRHHTEDTDENTQAAEIERRIEQEAKAEKHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETCARGNELQVPDCTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGENKKSGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEAGLL DIP protein P18064 original sequence version: 80 46BF8650E067F968 cand7_arath Protein CANDIDATE G-PROTEIN COUPLED RECEPTOR 7 CAND7 T28N17.5 At5g18520 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKMPLSVVVFLLFSAAFLAVSMAEIKSLVISDDARPMILFEKFGFTHTGHVTVSISSVSVVSTSSDPNPEASRLGFFLLSEESLLQVLLEIQQNPRFCVLDSHYVTHLFTFRDLSPPPNSRFNQSYPVTSPNEYSLFFANCVPETKVSMAVRTEMYNKDPNGSKDYLPAGSTQLPTLYSFFFLCYVAFLGFWSYTCWTNKQTVHRIHLLMAGLLLIKSLNLICAAEDKHYVKITGTPHGWDILFYIFQFIRVVLLFTVIILIGTGWSFLKPFLQEKEKNVLIIVIPLQVLANIASIVIGETGPFIKDWVTWNQVFLLVDIICCCAIIFPIVWSIRSLRETSKTDGKAARNLSKLTLFRQFYIVVIGYLYFTRIVVFALKTIAAYKYQWVSFAAEEIVSLVFYVIMFHMFRPEEKNEYFAVDDDEEEAAALALRDEEFEL 88FE6D603BA64E65 q9fvt5_arath Cand1 T8L23.15 T8L23_15 At1g57680 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPLTKLVPDAFGVVTICLVALLVLLGLLCIAYSFYFQSHVRKQGYIQLGYFSGPWIIRITFILFAIWWAVGEIFRLSLLRRHRRLLSGLDLRWQENVCKWYIVSNLGFAEPCLFLTLMFLLRAPLKMESGALSGKWNRDTAGYIILYCLPMLALQLAVVLSESRLNGGSGSYVKLPHDFTRTYSRVIIDHDEVALCTYPLLSTILLGVFAAVLTAYLFWLGRQILKLVINKRLQKRVYTLIFSVSSFLPLRIVMLCLSVLTAADKIIFEALSFLAFLSLFCFCVVSICLLVYFPVSDSMALRGLRDTDDEDTAVTEERSGALLLAPNSSQTDEGLSLRGRRDSGSSTQERYVELSLFLEAEN 3339C36FCA4620F0 gpa1-at3g59090 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Figure 1d Table 2 As shown in sector 2 of Figure 3d, the candidate GPCR Cand5 interacts with GPA1 as shown by the presence of yeast growth; however, this interaction does not occur when the Cand5 protein has a carboxy-terminal NubG or Cub fusion protein This interaction does not occur when the Cand5 protein has a carboxy-terminal NubG or Cub fusion protein The authors concluded that "a free carboxyl terminus is required for Cand1, 2, 3, 5, 7, and 8 to interact with GPA1". gpa1-at1g57680 1 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Table 2 Fusion proteins made using Cand1, 2, 3, 5, 7, 8 and HHP2 in the NubG-candidate orientation interacted with the GPA1-Cub-PLV fusion protein as indicated by yeast growth None of the test assays involving candidate-NubG constructs showed any interaction with GPA1 The authors concluded that "a free carboxyl terminus is required for Cand1, 2, 3, 5, 7, and 8 to interact with GPA1". gpa1-at3g05010 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 2 Fusion proteins made using Cand1, 2, 3, 5, 7, 8 and HHP2 in the NubG-candidate orientation interacted with the GPA1-Cub-PLV fusion protein as indicated by yeast growth None of the test assays involving candidate-NubG constructs showed any interaction with GPA1 The authors concluded that "a free carboxyl terminus is required for Cand1, 2, 3, 5, 7, and 8 to interact with GPA1". gpa1-at3g59090-1 1 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Table 2 Fusion proteins made using Cand1, 2, 3, 5, 7, 8 and HHP2 in the NubG-candidate orientation interacted with the GPA1-Cub-PLV fusion protein as indicated by yeast growth None of the test assays involving candidate-NubG constructs showed any interaction with GPA1 The authors concluded that "a free carboxyl terminus is required for Cand1, 2, 3, 5, 7, and 8 to interact with GPA1". gpa1-at5g18520 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 2 Fusion proteins made using Cand1, 2, 3, 5, 7, 8 and HHP2 in the NubG-candidate orientation interacted with the GPA1-Cub-PLV fusion protein as indicated by yeast growth None of the test assays involving candidate-NubG constructs showed any interaction with GPA1 The authors concluded that "a free carboxyl terminus is required for Cand1, 2, 3, 5, 7, and 8 to interact with GPA1". gpa1-at5g27210 1 7 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Table 2 Fusion proteins made using Cand1, 2, 3, 5, 7, 8 and HHP2 in the NubG-candidate orientation interacted with the GPA1-Cub-PLV fusion protein as indicated by yeast growth None of the test assays involving candidate-NubG constructs showed any interaction with GPA1 The authors concluded that "a free carboxyl terminus is required for Cand1, 2, 3, 5, 7, and 8 to interact with GPA1". gpa1-at4g30850 1 7 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association Table 2 Fusion proteins made using Cand1, 2, 3, 5, 7, 8 and HHP2 in the NubG-candidate orientation interacted with the GPA1-Cub-PLV fusion protein as indicated by yeast growth None of the test assays involving candidate-NubG constructs showed any interaction with GPA1, while all of the control assays showed heavy yeast growth except the assay involving HHP2, which did not show any growth