IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Rapid telomere movement in meiotic prophase is promoted by NDJ1, MPS3, and CSM4 and is modulated by recombination. Rapid telomere movement in meiotic prophase is promoted by NDJ1, MPS3, and CSM4 and is modulated by recombination. Cell (0092-8674) 2008 imex curation Conrad MN., Lee CY., Chao G., Shinohara M., Kosaka H., Shinohara A., Conchello JA., Dresser ME. dresserm@omrf.ouhsc.edu 27-Aug-2008: Contacted by JYOTI. davet Only protein-protein interactions 3 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Conrad MN., Lee CY., Chao G., Shinohara M., Kosaka H., Shinohara A., Conchello JA., Dresser ME. dresserm@omrf.ouhsc.edu Accepted 2008-AUG-31 by DAVET. Cell (0092-8674) 2008 davet Only protein-protein interactions 3 imex curation ndj1_yeast Non-disjunction protein 1 NDJ1 TAM1 Telomere-associated meiosis protein 1 YOL104C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKDNRLASILLQPVASSSGNCTEFHDSKLHTLQEELNFLPLEGVASNVCPPMFRGHKNYVFVLYCLNQVDLVTNLQDSTKRYYPLQIFKDCQLSSLVQKDFSHYFQLSRQKEGEDRNDSDTTLVNVVNSGVSRHRSQLLKMCIIPRICSFDKSNSKTYKLIQEYVNRFETVLTKFGPEKDFTKVYANWSKLIESFNELILHDLLVKWQQWSELTQPNATVHQNIPNVLRELVIKLTQRYFTFQPSYSCSIDEFTTILLNKNALSLLDVFRKPRKYKLNFGLWLDCQNGILIFTNGIVQMADEITSERVKSFVRPAHLLVLEDHSNDEAVKKLMFFTFSAILQCFTDEILNC 87C1A7DF9AA8C077 mps3_yeast Spindle pole body assembly component MPS3 J1310 J1315 YJL018W YJL019W MPS3 NEP98 Monopolar spindle protein 3 98 kDa nuclear envelope protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNSNEHRREEAGAANEQMPYNKAVKSAYADVLKDKMNREQEISLRAIKKGIYTDGGETDNYDMDKENDSAYEMFKKNLDFPLDQHNDDDDDDPYIEDNGQETDGYSDEDYTDEADKSFIEDSDSDSYDLESNSDFEENLESSGEAKKLKWRTYIFYGGLFFVFYFFGSFLMTTVKNNDLESHSSGATSSPGKSFSNLQKQVNHLYSELSKRDEKHSSELDKTVKIIVSQFEKNIKRLLPSNLVNFENDINSLTKQVETISTSMSELQRRNHKFTVENVTQWQDQLVKQLDTHLPQEIPVVINNSSSLLIIPELHNYLSALISDVIESPGIGTAGSAESRWEYDLNRYVKEILSNELQYIDKDYFIQEMNRRLQSNKQEIWEEITNRLETQQQQQQQQVQQDYSNVPQQYSSILMKRLIHQIYNSNQHQWEDDLDFATYVQGTKLLNHLTSPTWRQGSGVQPIELLTDSKQSSSTYWQCENEPGCSWAIRFKTPLYLTKISYMHGRFTNNLHIMNSAPRLISLYVKLSQTKEIKALQTLANQYGFGQHHKRDRNYIKIAKFEYRLTDSRIRQQMYLPPWFIQLKPLVRSIVFQVDENYGNKKFISLRKFIINGVTPQDLQIIENNEFPVLLGDTPEYGVTQNTDEGKRKVLLSKPPYASSSTSTKFHPASNVPSFGQDELDQ 71B54CEB2B876815 csm4_yeast Chromosome segregation in meiosis protein 4 CSM4 YPL200W protein protein yeast Saccharomyces cerevisiae Baker's yeast MMDGSITRKVTSTLSNQLATWKWKLQLSLLERKLATINNDYFLLQWELLFITNEVMKWKEMIAFLESQLFCTTQNFVAQETHDRETFQSLVDDYNKQLSENNLIISVLKSRPQLSSFPIYLSDEVCSHLKFVIAELNSLIIVFFISLVFLWVSIEV 20386CDD5C39D11F mps3-csm4 1 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6 E Immune precipitation of Mps3p-FLAG coprecipitates Csm4p and Ndj1p-HA mps3-ndj1 1 2 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 E In immune co-IP experiments, Mps3p pulls down Ndj1p even in the absence of Csm4p mps3-csm4-2 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 E In immune co-IP experiments, Mps3p pulls down Ndj1p even in the absence of Csm4p and pulls down Csm4p even in the absence of Ndj1p