IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. J. Biol. Chem. (0021-9258) 2008 imex curation Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin CH., Chang HS., Yu WC. The positive control interaction (p53-SV40 T) was not curated as the source of p53 is not found in the text of the paper. hschang@mail.ncku.edu.tw Accepted 2008-OCT-23 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 orchard Only protein-protein interactions imex curation USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. J. Biol. Chem. (0021-9258) 2008 imex curation Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. orchard Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw Accepted 2008-OCT-23 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 orchard Only protein-protein interactions imex curation USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. J. Biol. Chem. (0021-9258) 2008 imex curation Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. orchard Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw Accepted 2008-OCT-23 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 orchard Only protein-protein interactions imex curation USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. J. Biol. Chem. (0021-9258) 2008 imex curation Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. orchard Only protein-protein interactions human-caski Homo sapiens CaSki caski Human cervical carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw Accepted 2008-OCT-23 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 orchard Only protein-protein interactions imex curation USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. J. Biol. Chem. (0021-9258) 2008 imex curation Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw Accepted 2008-OCT-23 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 orchard Only protein-protein interactions imex curation ve7_hpv18 Protein E7 E7 protein protein hpv18 Human papillomavirus type 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ DIP protein P06788 original sequence version: 78 2CDB119534D0186A ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP DIP protein P03129 original sequence version: 96 9BD612534CD2C9EB ubp11_human Ubiquitin carboxyl-terminal hydrolase 11 USP11 UHX1 Ubiquitin-specific-processing protease 11 Deubiquitinating enzyme 11 Ubiquitin thioesterase 11 protein protein human Homo sapiens Human MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAAAAAVTEDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERMMVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNSDDEDDGDEKEDDEEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFMDVN DIP protein P51784 original sequence version: 155 876FDC41945AFD9B e7-usp11 5 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait physical association physical association The authors state that intact HPV-16E7 was used and give the range as aa 1-97. However, the length of the UniProtKB entry for this protein is 98 aa. The cDNA library from HeLa cell was screened using intact HPV-16E7 (amino acids 1-97) as bait. One of the cDNA encoding the carboxyl-terminal domain of USP11 was repeatedly isolated A C-terminal region of USP11 bound to HPV-16E7. However, the authors do not specify the range. e7-usp11-1 1 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait physical association physical association The authors state that intact HPV-16E7 was used and give the range as aa 1-97. However, the length of the UniProtKB entry for this protein is 98 aa. A C-terminal region of USP11 bound to HPV-16E7. However, the authors do not specify the range. 1 co-expression of the HPV-16E7 and the C-terminal of USP11 (USP11-C) rendered the yeast strain CG1945/Y187 able to grow on SD/-Leu/-Trp/-His/-Ade minimal plates e7-usp11-2 1 8 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role bait bait physical association physical association A C-terminal region of USP11 bound to HPV-18E7. However, the authors do not specify the range. 1 co-expression of the HPV-16E7 and the C-terminal of USP11 (USP11-C) rendered the yeast strain CG1945/Y187 able to grow on SD/-Leu/-Trp/-His/-Ade minimal plates e7-usp11-3 2 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 A The result showed that Flag-USP11 was co-precipitated with Flag-HPV-16E7 P51784; P03129 transfection e7-usp11-4 3 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 B the Flag antibody coprecipitated HA-USP11 from extracts of cells transiently transfected with both Flag-HPV-16E7 and HA-USP11 P03129; P51784 transfection e7-usp11-5 4 8 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role prey prey in vitro In vitro physical association physical association 2 D USP11 was co-precipitated with HPV-16E7 e7-usp11-6 3 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4 A HPV-16E7 associates with USP11