MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. EMBO J. (0261-4189) 2008 imex curation Burkhardt P., Hattendorf DA., Weis WI., Fasshauer D. 2009-01-08 Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Burkhardt P., Hattendorf DA., Weis WI., Fasshauer D. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. EMBO J. (0261-4189) 2008 imex curation Burkhardt P., Hattendorf DA., Weis WI., Fasshauer D. 2009-01-08 Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Burkhardt P., Hattendorf DA., Weis WI., Fasshauer D. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. Munc18a controls SNARE assembly through its interaction with the syntaxin N-peptide. EMBO J. (0261-4189) 2008 imex curation Burkhardt P., Hattendorf DA., Weis WI., Fasshauer D. 2009-01-08 Only protein-protein interactions in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Burkhardt P., Hattendorf DA., Weis WI., Fasshauer D. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA vamp2_rat Vesicle-associated membrane protein 2 Vamp2 Syb2 Synaptobrevin-2 protein protein rat Rattus norvegicus (Rat) Rat MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST DIP protein P63045 original sequence version: 95 DIP protein P63045 original sequence version: 90 DIP protein P63045 original sequence version: 64 DIP protein P63045 original sequence version: 62 DIP protein P63045 original sequence version: 85 DIP protein P63045 original sequence version: 104 DIP protein P63045 original sequence version: 77 DIP protein P63045 original sequence version: 75 DIP protein P63045 original sequence version: 106 4A0D0D56B5409D0A vps45_rat Vacuolar protein sorting-associated protein 45 Vps45 Vps45a protein protein rat Rattus norvegicus (Rat) Rat MNVVFAVKQYISKMIEDSGPGMKVLLMDKETTGIVSMVYTQSEILQKEVYLFERIDSQNREIMKHLKAICFLRPTKENVDSLIQELRRPKYSIYFIYFSNVISKSDVKSLAEADEQEVVAEVQEFYGDYIAVNPHLFSLNILGCCQGRNWDPAQLSRTTQGLTALLLSLKKCPMIRYQLSSEAAKRLGECVKQVISKEYELFEFRRTEVPPLLLILDRCDDAITPLLNQWTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKRPKEQQKLESIADMKAFVENYPQFKKMSGTVSKHVTVVGELSRLVSERNLLEVSEVEQELACQNDHSSALQNVKRLLQNPKVTEFDAVRLVMLYALHYERHSSNSLPGLIVDLRSKGVAEKYRKLVSAVVEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDHLIKGKLKENLYPYLGPSTLRDRPQDIIVFVIGGATYEEALTVYNLNRTTPGVRIVLGGTTIHNTKSFLEEVLASGLHSRSRESSQATSRSASRR mint May play a role in vesicle-mediated protein trafficking from the Golgi stack through the trans-Golgi network 0FF5E2D8E7E7E571 stx16_mouse Syntaxin-16 Stx16 protein protein mouse Mus musculus Mouse MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNRKMLVIVILVAVIIVLLVALVAVKSR E1042EA1A15372B6 snp25_rat Synaptosomal-associated protein 25 Snap25 Snap Synaptosomal-associated 25 kDa protein Super protein protein protein rat Rattus norvegicus (Rat) Rat MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG DIP protein P60881 original sequence version: 105 DIP protein P60881 original sequence version: 40 DIP protein P60881 original sequence version: 106 DIP protein P60881 original sequence version: 78 DIP protein P60881 original sequence version: 75 DIP protein P60881 original sequence version: 100 DIP protein P60881 original sequence version: 120 DIP protein P60881 original sequence version: 131 DIP protein P60881 original sequence version: 93 FBED2B082A4CB6A6 stxb1_rat Syntaxin-binding protein 1 Stxbp1 Unc18a Protein unc-18 homolog 1 Protein unc-18 homolog A N-Sec1 rbSec1 p67 protein protein rat Rattus norvegicus (Rat) Rat MAPIGLKAVVGEKIMHDVIKKVKKKGEWKVLVVDQLSMRMLSSCCKMTDIMTEGITIVEDINKRREPLPSLEAVYLITPSEKSVHSLISDFKDPPTAKYRAAHVFFTDSCPDALFNELVKSRAAKVIKTLTEINIAFLPYESQVYSLDSADSFQSFYSPHKAQMKNPILERLAEQIATLCATLKEYPAVRYRGEYKDNALLAQLIQDKLDAYKADDPTMGEGPDKARSQLLILDRGFDPSSPVLHELTFQAMSYDLLPIENDVYKYETSGIGEARVKEVLLDEDDDLWIALRHKHIAEVSQEVTRSLKDFSSSKRMNTGEKTTMRDLSQMLKKMPQYQKELSKYSTHLHLAEDCMKHYQGTVDKLCRVEQDLAMGTDAEGEKIKDPMRAIVPILLDANVSTYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYPYISTRSSASFSTTAVSARYGHWHKNKAPGEYRSGPRLIIFILGGVSLNEMRCAYEVTQANGKWEVLIGSTHILTPQKLLDTLKKLNKTDEEISS DIP protein P61765 original sequence version: 98 DIP protein P61765-1 original sequence version: 86 DIP protein P61765-1 original sequence version: 79 DIP protein P61765 original sequence version: 116 2DD0715F875CE0F3 stx1a-stxbp1-3 1 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548801: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction T1 f1 kd 1.4 nanomolar homomint mint stx1a-stxbp1-4 1 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548816: original sequence: 25-262 : DRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA direct interaction direct interaction T1 f1 kd 8.1 nanomolar homomint mint stx1a-stxbp1-5 1 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548867: original sequence: 1-240 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEH Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction T1 kd 2.7 nanomolar homomint mint stx1a-stxbp1-6 1 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548902: original sequence: 1-226 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVES Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction T1 kd 621 nanomolar homomint mint stx1a-stxbp1-7 1 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548912: original sequence: 1-179 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFA Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction T1 kd 693 nanomolar homomint mint stx1a-stxbp1-8 1 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Ile233Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:52:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:24:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile233ala' Tue Jun 30 18:34:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile233Ala' range MINT-6548947: original sequence: 233-233 : VESQGEMIDRIEYNVEHAVD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548940: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA direct interaction direct interaction T1 kd 333 nanomolar homomint mint stx1a-stxbp1-9 1 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548955: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA P32851:p.Arg4Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:52:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:38:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg4ala' Tue Jun 30 18:04:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg4Ala' range MINT-6548953: original sequence: 4-4 : MKDRTQELRTAKD direct interaction direct interaction T1 kd 9.4 nanomolar homomint mint stx1a-stxbp1-10 1 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Thr5Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:12:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:19:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr5ala' Tue Jun 30 17:23:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr5Ala' range MINT-6548972: original sequence: 5-5 : MKDRTQELRTAKDS binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548970: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction T1 kd 1.9 nanomolar homomint mint stx1a-stxbp1-11 1 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Leu8Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:51:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:25:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu8ala' Tue Jun 30 19:48:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu8Ala' range MINT-6548983: original sequence: 8-8 : MKDRTQELRTAKDSDDD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548985: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction T1 kd 9.1 nanomolar homomint mint stx1a-stxbp1-12 1 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Thr10Ala mutation decreasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:10:09 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:23:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr10ala' Tue Jun 30 15:52:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr10Ala' range MINT-6549001: original sequence: 10-10 : MKDRTQELRTAKDSDDDDD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6548999: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA direct interaction direct interaction T1 kd 0.4 nanomolar homomint mint stx1a-stxbp1-13 1 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549014: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA P32851:p.Ser14Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Tue Jul 12 10:09:21 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:18:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser14ala' Tue Jun 30 17:27:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser14Ala' range MINT-6549012: original sequence: 14-14 : RTQELRTAKDSDDDDDVTVT direct interaction direct interaction T1 kd 2.6 nanomolar homomint mint stx16-vps45 1 vps45 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified syx16 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6549027: original sequence: 1-302 : MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAADVDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNR [EBI-7849234]The shifted ranges (1-302) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7849234]1-302 [EBI-7849234]Q8BVI5,2 direct interaction direct interaction kd 2.1 nanomolar T1 f5 Mouse syntaxin 16 uniprot ID has been used instead of the rat one. homomint mint stx16-vps45-1 1 vps45 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified syx16 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6549041: original sequence: 1-302 : MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAADVDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNR [EBI-7849255]The shifted ranges (1-302) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7849255]1-302 [EBI-7849255]Q8BVI5,2 Q8BVI5:p.Phe10Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:19:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:17:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe10ala' Tue Jun 30 18:00:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe10Ala' range MINT-6549051: original sequence: 10-10 : MATRRLTDAFLLLRNNSIQ direct interaction direct interaction T1 kd 116.6 nanomolar Mouse syntaxin 16 uniprot ID has been used instead of the rat one. homomint mint stx16-vps45-2 1 vps45 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified syx16 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q8BVI5:p.Phe10Ala mutation decreasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Tue Jul 12 10:17:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:18:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe10ala' Tue Jun 30 17:38:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe10Ala' range MINT-6549059: original sequence: 10-10 : MATRRLTDAFLLLRNNSIQ binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6549061: original sequence: 1-302 : MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAADVDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNR [EBI-7849286]The shifted ranges (1-302) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7849286]1-302 [EBI-7849286]Q8BVI5,2 direct interaction direct interaction kd 26.9 nanomolar T1 F5 Mouse syntaxin 16 uniprot ID has been used instead of the rat one. homomint mint stx16-vps45-3 1 vps45 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified syx16 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6549094: original sequence: 1-279 : MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAADVDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQ [EBI-7849324]The shifted ranges (1-279) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7849324]1-279 [EBI-7849324]Q8BVI5,2 direct interaction direct interaction T1 kd 085 nanomolar Mouse syntaxin 16 uniprot ID has been used instead of the rat one. homomint mint stx16-vps45-4 1 vps45 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified syx16 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6549104: original sequence: 1-265 : MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAADVDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVE [EBI-7849345]The shifted ranges (1-265) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7849345]1-265 [EBI-7849345]Q8BVI5,2 direct interaction direct interaction T1 kd 11.7 nanomolar Mouse syntaxin 16 uniprot ID has been used instead of the rat one. homomint mint stx16-vps45-5 1 vps45 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified syx16 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6549118: original sequence: 1-183 : MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAADVDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQS [EBI-7849366]The shifted ranges (1-183) couldn't be applied as the new full feature sequence is different from the previous one. [EBI-7849366]1-183 [EBI-7849366]Q8BVI5,2 direct interaction direct interaction T1 kd 32.5 nanomolar Mouse syntaxin 16 uniprot ID has been used instead of the rat one. homomint mint stx1a-stxbp1-14 1 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Glu166Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:15:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 19:49:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu166ala' Tue Jun 30 17:48:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu166Ala' range MINT-6549228: original sequence: 166-166 : TGRTTTSEELEDMLESGNPA P32851:p.Leu165Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:54:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:09:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu165ala' Tue Jun 30 20:13:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu165Ala' range MINT-6549220: original sequence: 165-165 : ITGRTTTSEELEDMLESGNP binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549218: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA direct interaction direct interaction T1 kd 7.7 nanomolar homomint mint snap25-stx1a-4 2 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549140: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Syb2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549152: original sequence: 1-96 : MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM Snap25 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549155: original sequence: 1-206 : MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGS physical association physical association F4C When a fluorescently labelled cytosolic domain of synaptobrevin 2 was mixed with SNAP-25 and Syx1a (1 262) or Syx1a (25 262) in the absence of Munc18a, an increase in fluorescence anisotropy corresponding to the formation of a ternary SNARE complex was observed. As was seen in the SDS resistance assay, pre-mixing Munc18a with Syx1a (1 262) produced an almost complete block of ternary SNARE complex formation, whereas no inhibition was found when Munc18a and Syx1a (25 262) were pre-mixed. homomint mint snap25-stx1a-5 2 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549169: original sequence: 25-262 : DRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Snap25 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549165: original sequence: 1-206 : MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGS Syb2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549161: original sequence: 1-96 : MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM physical association physical association F4D When a fluorescently labelled cytosolic domain of synaptobrevin 2 was mixed with SNAP-25 and Syx1a (1 262) or Syx1a (25 262) in the absence of Munc18a, an increase in fluorescence anisotropy corresponding to the formation of a ternary SNARE complex was observed. As was seen in the SDS resistance assay, pre-mixing Munc18a with Syx1a (1 262) produced an almost complete block of ternary SNARE complex formation, whereas no inhibition was found when Munc18a and Syx1a (25 262) were pre-mixed. homomint mint stx1a-stxbp1-15 2 Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Leu165Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:59:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:18:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu165ala' Tue Jun 30 20:11:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu165Ala' range MINT-6549239: original sequence: 165-165 : ITGRTTTSEELEDMLESGNP P32851:p.Glu166Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:24:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:31:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu166ala' Tue Jun 30 19:35:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu166Ala' range MINT-6549237: original sequence: 166-166 : TGRTTTSEELEDMLESGNPA binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549241: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA direct interaction direct interaction SF1D kd 0.3 nanomolar homomint mint stx1a-stxbp1-16 2 Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P32851:p.Ile233Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:21:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 20:32:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile233ala' Tue Jun 30 16:26:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile233Ala' range MINT-6549263: original sequence: 233-233 : VESQGEMIDRIEYNVEHAVD binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549261: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Munc18a 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction SF1B kd 0.3 nanomolar homomint mint snap25-stx1a-6 3 Snap25 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549185: original sequence: 1-206 : MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGS Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549189: original sequence: 1-262 : MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Syb2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549181: original sequence: 1-96 : MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM association association F4A When Syx1a (1 262) or Syx1a (25 262) were mixed with SNAP-25 and synaptobrevin, SDS-resistant complexes formed over time. When Munc18a and Syx1a (1 262) were pre-mixed, hardly any SDS-resistant complex was formed upon addition of SNAP-25 and synaptobrevin. homomint mint snap25-stx1a-7 3 Syb2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549207: original sequence: 1-96 : MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM Syx1A 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549199: original sequence: 25-262 : DRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA Snap25 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6549203: original sequence: 1-206 : MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGS association association F4B When Syx1a (1 262) or Syx1a (25 262) were mixed with SNAP-25 and synaptobrevin, SDS-resistant complexes formed over time. When Munc18a and Syx1a (1 262) were pre-mixed, hardly any SDS-resistant complex was formed upon addition of SNAP-25 and synaptobrevin. homomint mint