IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Regulation of a late phase of T cell polarity and effector functions by Crtam. Regulation of a late phase of T cell polarity and effector functions by Crtam. Cell (0092-8674) 2008 imex curation Yeh JH., Sidhu SS., Chan AC. acc@gene.com 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions 9 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yeh JH., Sidhu SS., Chan AC. acc@gene.com Accepted 2008-MAY-30 by DAVET. Cell (0092-8674) 2008 davet Only protein-protein interactions 9 imex curation Regulation of a late phase of T cell polarity and effector functions by Crtam. Regulation of a late phase of T cell polarity and effector functions by Crtam. Cell (0092-8674) 2008 imex curation Yeh JH., Sidhu SS., Chan AC. acc@gene.com 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions 9 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yeh JH., Sidhu SS., Chan AC. acc@gene.com Accepted 2008-MAY-30 by DAVET. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 9 imex curation Regulation of a late phase of T cell polarity and effector functions by Crtam. Regulation of a late phase of T cell polarity and effector functions by Crtam. Cell (0092-8674) 2008 imex curation Yeh JH., Sidhu SS., Chan AC. acc@gene.com 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions 9 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes confocal microscopy confocal microscopy immunostaining immunostaining Yeh JH., Sidhu SS., Chan AC. acc@gene.com Accepted 2008-MAY-30 by DAVET. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 9 imex curation Regulation of a late phase of T cell polarity and effector functions by Crtam. Regulation of a late phase of T cell polarity and effector functions by Crtam. Cell (0092-8674) 2008 imex curation Yeh JH., Sidhu SS., Chan AC. acc@gene.com 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions 9 mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes confocal microscopy confocal microscopy immunostaining immunostaining Yeh JH., Sidhu SS., Chan AC. naive CD4+ T cells acc@gene.com Accepted 2008-MAY-30 by DAVET. 25-Jun-2008: Contacted by JYOTI. Cell (0092-8674) 2008 davet Only protein-protein interactions 9 imex curation cdc42_mouse Cell division control protein 42 homolog Cdc42 G25K GTP-binding protein protein protein mouse Mus musculus Mouse MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60766 original sequence version: 61 51A437E22A4D8FFF crtam_mouse Cytotoxic and regulatory T-cell molecule Crtam Class-I MHC-restricted T-cell-associated molecule protein protein mouse Mus musculus Mouse MWWGALSLLFWVPVQAAFLKMETVTVEEGQTLTLTCVTSQTKNVSLQWLAPSGFTIFLNQHPALKSSKYQLLHHSATQLSISVSNVTLREEGVYTCLHYGSSVKTKQVRVTVLVTPFQPTVEALVLRRQNGEKSVVLKCSTERSKPPPQITWLLGEGLEIYGELNHEFEADGKICNTSSMLIARAYGKNSTVHCIIQHEGLHGRKLVAPFQFEDLVADQETSDQETSDAPEQSSLSSQALQQPTSTVSMMENSSIPETDKEEKEHATQDPGLSTEASAQHTGLARRKSGILLLTLVSFLIFILFIIVQLFIMKLRKAHVVWKKESEISEQALESYRSRSNNEETSSQENSSQAPQSKRCMNYITRLYSGAKTKKSAQHWKLGGKHSRVPESIV 74666FFB7844D2B3 scrib_mouse Protein scribble homolog Scrib Kiaa0147 Lap4 Scrib1 Protein LAP4 protein protein mouse Mus musculus Mouse MLKCIPLWRCNRHVESVDKRHCSLQVVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSLQALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPELGNLRRLVCLDVSENRLEELPVELGGLALLTDLLLSQNLLQRLPEGIGQLKQLSILKVDQNRLCEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEVLPPEIGGCVALSVLSLRDNRLAVLPPELAHTAELHVLDVAGNRLRSLPFALTHLNLKALWLAENQAQPMLRFQTEDDAQTGEKVLTCYLLPQQPLPSLEDAGQQSSPSESCSDAPLSRVSVIQFEDTLEGEEDAEEAAAEKRGLQRRATPHPSELKVMKRGIEERRNEAFVCKPDPSPPSPSEEEKRLSAESALSGGSVPSASTASEGEPEILPAEVQGLGQHEAMPAQEEYTEDDYNEPTVHFAEDTLIPREDGESEEGQPEAAWPLPSGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGVQTDREGPTAGWHNGPHTPWAPRAHEEEEEEEEENRDEEEGEATTEEDDKEEAVASAPSVKGVSFDQANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAARAGVRVGDKLLEVNGVALQDAEHHEAVEALRGAGAAVQMRVWRERMVEPENAVTITPLRPEDDYSPREWRGGGLRLPLLQPETPVSLRQRHAACLVRSEKGLGFSIAGGKGSTPYRAGDGGIFISRIAEGGAAHRAGTLQVGDRVLSINGVDMTEARHDHAVSLLTAASPTISLLLERETGGTYPPSPPPHSSPTPAATVAATVSTAVPGEPLLPRLSPSLLATALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQDPGVFISKVLPRGLAARCGLRVGDRILAVNGQDVREATHQEAVSALLRPCLELCLLVRRDPPPPGMRELCIQKAPGEKLGISIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHAEAVQLLRSVGDTLTVLVCDGFDTSTTTALEVSPGVIANPFAAGLGHRNSLESISSIDRELSPEGPGKEKELASQALPWESESAETTGRNLEPLKLDYRALAALPSAGSLQRGPSATTGGKTTEAPCSPGSQQPPSPDELPANVKQAYRAFAAVPTVHPPENSATQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREEAVTSGPDMGLASDRESPDDQQEAEQPWAVPSHAGGSSPSSPPPLGGNAPVRTAKAERRHQERLRMQSPELPAPERALSPAERRALEAEKRALWRAARMKSLEQDALRAQMVLSKSQEGRGKRGPLERLAEAPSPAPTPSPTPLEDFGLQTSASPGRLSPDFVEELRTLEASPSPGSQEEDGEVALVLLGRPSPGAVGPEDMTLCSSRRSVRPGRRGLGPVPS DIP protein Q80U72 original sequence version: 107 8C85DB322D738EDE kpcd_mouse Protein kinase C delta type nPKC-delta Tyrosine-protein kinase PRKCD Prkcd Pkcd protein protein mouse Mus musculus Mouse MAPFLRISFNSYELGSLQVEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKTTFDAHIYEGRVIQIVLMRAAEDPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMCVQYFLEDGDCKQSMRSEEEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRSSRKLDTTESVGIYQGFEKKPEVSGSDILDNNGTYGKIWEGSTRCTLENFTFQKVLGKGSFGKVLLAELKGKDKYFAIKCLKKDVVLIDDDVECTMVEKRVLALAWESPFLTHLICTFQTKDHLFFVMEFLNGGDLMFHIQDKGRFELYRATFYAAEIICGLQFLHSKGIIYRDLKLDNVMLDRDGHIKIADFGMCKENIFGEGRASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDIMEKLFERDPDKRLGVTGNIRIHPFFKTINWSLLEKRKVEPPFKPKVKSPSDYSNFDPEFLNEKPQLSFSDKNLIDSMDQEAFHGFSFVNPKFEQFLDI DIP protein P28867 original sequence version: 135 6E9F753348F03D59 scrib-crtam-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Anti-CD3/28(10:2 ug/ml) mAbs for 14 hours. Crtam was detected in Scrib, but not Dlg1, immunoprecipitates Fig. 4A scrib-crtam-2 3 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Anti-CD3/28(10:2 ug/ml) mAbs for 14 hours. The biochemical interaction was further supported by analysis with confocal microscopy demonstrating coaccumulation of Scrib and Crtam in naive T cells activated for 14 hr with plate-bound anti-CD3/28 mAbs Fig. 4B scrib-cdc42-1 3 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Anti-CD3/28(10:2 ug/ml) mAbs for 14 hours. Scrib and Cdc42 polarization and coaccumulation Fig. 4C Cocalisation requires the presence of Ctram scrib-prkcd-1 3 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Anti-CD3/28(10:2 ug/ml) mAbs for 14 hours. Fig. 4D Cocalisation requires the presence of Ctram scrib-tln1-1 3 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Anti-CD3/28(10:2 ug/ml) mAbs for 14 hours. Analysis of naive CD4+ T cells revealed that Crtam, Talin, and CD3 coaccumulated Fig. 4C Cocalisation requires the presence of Ctram scrib-crtam-3 2 7 unspecified role unspecified role prey prey pdz3 region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association Crtam interacts with Scrib PDZ3 Supp. Fig. 9A scrib-crtam-4 4 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization OVA peptide coaccumulation of Scrib and Crtam in naive T cells activated for 14 hr with plate-bound anti-CD3/28 mAbs (Figure 4B, panels 1�3) and with OVA-pulsed dendritic cells (DCs) (Figure S10A, top). Supp. Fig. 10A scrib-prkcd-2 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization OVA peptide Supp. Fig. 10C scrib-cdc42-2 4 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp. Fig. 10B Cocalisation requires the presence of Ctram OVA peptide