IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. BMB Rep (1976-6696) 2008 imex curation Shen H., Cao K., Wang X. xipingwang@hotmail.com 27-Aug-2008: Contacted by JYOTI. jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shen H., Cao K., Wang X. xipingwang@hotmail.com Accepted 2008-AUG-22 by JYOTI. 27-Aug-2008: Contacted by JYOTI. BMB Rep (1976-6696) 2008 jyoti Only protein-protein interactions imex curation AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana. BMB Rep (1976-6696) 2008 imex curation Shen H., Cao K., Wang X. xipingwang@hotmail.com 27-Aug-2008: Contacted by JYOTI. jyoti Only protein-protein interactions in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa predetermined predetermined participant predetermined Shen H., Cao K., Wang X. xipingwang@hotmail.com Accepted 2008-AUG-22 by JYOTI. BMB Rep (1976-6696) 2008 jyoti Only protein-protein interactions imex curation cbox-arath-dna C Box dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TGACGTCA D9DEA1A87EBDD861 gbf3_arath G-box-binding factor 3 GBF3 BZIP55 T3F17.8 At2g46270 bZIP transcription factor 55 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNSSEEPKPPTKSDKPSSPPVDQTNVHVYPDWAAMQAYYGPRVAMPPYYNSAMAASGHPPPPYMWNPQHMMSPYGAPYAAVYPHGGGVYAHPGIPMGSLPQGQKDPPLTTPGTLLSIDTPTKSTGNTDNGLMKKLKEFDGLAMSLGNGNPENGADEHKRSRNSSETDGSTDGSDGNTTGADEPKLKRSREGTPTKDGKQLVQASSFHSVSPSSGDTGVKLIQGSGAILSPGVSANSNPFMSQSLAMVPPETWLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANATLLDKLKCSEPEKRVPANMLSRVKNSGAGDKNKNQGDNDSNSTSKLHQLLDTKPRAKAVAAG 48B31762CDCD977C gbf1_arath G-box-binding factor 1 GBF1 BZIP41 At4g36730 C7A10_630 bZIP transcription factor 41 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGTSEDKMPFKTTKPTSSAQEVPPTPYPDWQNSMQAYYGGGGTPNPFFPSPVGSPSPHPYMWGAQHHMMPPYGTPVPYPAMYPPGAVYAHPSMPMPPNSGPTNKEPAKDQASGKKSKGNSKKKAEGGDKALSGSGNDGASHSDESVTAGSSDENDENANQQEQGSIRKPSFGQMLADASSQSTTGEIQGSVPMKPVAPGTNLNIGMDLWSSQAGVPVKDERELKRQKRKQSNRESARRSRLRKQAECEQLQQRVESLSNENQSLRDELQRLSSECDKLKSENNSIQDELQRVLGAEAVANLEQNAAGSKDGEGTN 8585EF0249C91C21 bzp68_arath bZIP transcription factor 68 BZIP68 F3C3.7 At1g32150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSSEMEKSGKEKEPKTTPPSTSSSAPATVVSQEPSSAVSAGVAVTQDWSGFQAYSPMPPHGYVASSPQPHPYMWGVQHMMPPYGTPPHPYVTMYPPGGMYAHPSLPPGSYPYSPYAMPSPNGMAEASGNTGSVIEGDGKPSDGKEKLPIKRSKGSLGSLNMIIGKNNEAGKNSGASANGACSKSAESGSDGSSDGSDANSQNDSGSRHNGKDGETASESGGSAHGPPRNGSNLPVNQTVAIMPVSATGVPGPPTNLNIGMDYWSGHGNVSGAVPGVVVDGSQSQPWLQVSDEREIKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNGENSSLRAEINKLKSQYEELLAENSSLKNKFSSAPSLEGGDLDKNEQEPQRSTRQDVA CDFBD3E348BE04CC as1_box-arath-dna AS1 Box dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TGACGTAA D9DDC1A87EBDD861 gbf2_arath G-box-binding factor 2 GBF2 BZIP54 F2N1.12 At4g01120 bZIP transcription factor 54 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGSNEEGNPTNNSDKPSQAAAPEQSNVHVYHHDWAAMQAYYGPRVGIPQYYNSNLAPGHAPPPYMWASPSPMMAPYGAPYPPFCPPGGVYAHPGVQMGSQPQGPVSQSASGVTTPLTIDAPANSAGNSDHGFMKKLKEFDGLAMSISNNKVGSAEHSSSEHRSSQSSENDGSSNGSDGNTTGGEQSRRKRRQQRSPSTGERPSSQNSLPLRGENEKPDVTMGTPVMPTAMSFQNSAGMNGVPQPWNEKEVKREKRKQSNRESARRSRLRKQAETEQLSVKVDALVAENMSLRSKLGQLNNESEKLRLENEAILDQLKAQATGKTENLISRVDKNNSVSGSKTVQHQLLNASPITDPVAAS 060EEFCB168BBB17 gbox-arath-dna G Box oligonucleotide dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress CCACGTGG C77861A87EBDDEBE hex_box-arath-dna dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress TGACGTGG DC7861A87EBDD861 bzp16_arath bZIP transcription factor 16 BZIP16 At2g35530 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASNEMEKSSKEKEPKTPPPSSTAPPSSQEPSSAVSAGMATPDWSGFQAYSPMPPPHGYVASSPQPHPYMWGVQHMMPPYGTPPHPYVAMYPPGGMYAHPSMPPGSYPYSPYAMPSPNGMTEVSGNTTGGTDGDAKQSEVKEKLPIKRSRGSLGSLNMITGKNNEPGKNSGASANGAYSKSGESASDGSSEGSDGNSQNDSGSGLDGKDAEAASENGGSANGPQNGSAGTPILPVSQTVPIMPMTAAGVPGPPTNLNIGMDYWGAPTSAGIPGMHGKVSTPVPGVVAPGSRDGGHSQPWLQDDRELKRQRRKQSNRESARRSRLRKQAECDELAQRAEVLNEENTNLRAEINKLKSQCEELTTENTSLKDQLSLFPPLEGISMDNDHQEPDTNQTGAAERKVDSYKDST 5C687D6938077C67 at2g35530-gbox 2 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figure 3a Figure 4a at1g32150-gbox-1 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figure 3a Figure 3b Figure 3c Figure 4a A 50 fold amount of non-radio-labeled G box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled G box oligonucleotide. The authors state that AtbZIP68 had the highest binding affinity for the G box motif , compared to Hex-box, C box or As-1 motifs. at1g32150-hex_box 2 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 3a Figure 3b Figure 3c A 100 fold amount of non-radio-labeled Hex box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled Hex box oligonucleotide. The authors state that AtbZIP68 had a lower binding affinity for the Hex box motif , compared to G-box motifs. at1g32150-cbox 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 3 unspecified role unspecified role bait bait direct interaction direct interaction Figure 3a Figure 3b Figure 3c More than a 100 fold amount of non-radio-labeled C box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled C box oligonucleotide. The authors state that AtbZIP68 had a lower binding affinity for the C box motif , compared to G-box motifs. at1g32150-as1 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role bait bait direct interaction direct interaction Figure 3a Figure 3b Figure 3c More than a 100 fold amount of non-radio-labeled AS-1 box oligonucleotide efficiently competed for binding of AtbZIP68 with radio-labeled AS-1 box oligonucleotide. The authors state that AtbZIP68 had a lower binding affinity for the AS-1 box motif , compared to G-box motifs. at2g35530-gbox-1 2 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction Figure 4a gbf1-gbox 2 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4a Figure 4b gbf1-at2g35530-gbox 2 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figure 4a gbf2-gbox 2 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figure 4a Figure 4b gbf2-at2g35530-gbox 2 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction Figure 4a gbf3-at2g35530-gbox 2 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey in vitro In vitro 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4a gbf3-gbox- 2 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4a at1g32150-gbox-2 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4b at1g32150-gbox-3 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role prey prey in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figure 4a gbf1-at1g32150-gbox 2 9 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 6 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction Figure 4b gbf2-gbox-at1g32150 2 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction Figure 4b gbf3-gbox-at1g32150 2 6 unspecified role unspecified role prey prey in vitro In vitro 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figure 4b at1g32150 1 6 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Figure 4c at1g32150-at2g35530 1 6 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Figure 4d gbf1-at1g32150 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association Figure 4d gbf2-at1g32150 1 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association Figure 4d gbf3-at1g32150 1 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait physical association physical association Figure 4d at2g35530 1 11 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4d gbf1-at2g35530 1 11 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4d gbf3-at2g35530 1 11 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4d gbf2-at2g35530 1 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4d