MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Spindle assembly checkpoint gene mdf-1 regulates germ cell proliferation in response to nutrition signals in C. elegans. Spindle assembly checkpoint gene mdf-1 regulates germ cell proliferation in response to nutrition signals in C. elegans. EMBO J. (0261-4189) 2008 imex curation Watanabe S., Yamamoto TG., Kitagawa R. 2009-01-08 Only protein-protein interactions caeel-larva Immature form of the adult worm larva Immature form of an organism anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Watanabe S., Yamamoto TG., Kitagawa R. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation Spindle assembly checkpoint gene mdf-1 regulates germ cell proliferation in response to nutrition signals in C. elegans. Spindle assembly checkpoint gene mdf-1 regulates germ cell proliferation in response to nutrition signals in C. elegans. EMBO J. (0261-4189) 2008 imex curation Watanabe S., Yamamoto TG., Kitagawa R. 2009-01-08 Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Watanabe S., Yamamoto TG., Kitagawa R. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation Spindle assembly checkpoint gene mdf-1 regulates germ cell proliferation in response to nutrition signals in C. elegans. Spindle assembly checkpoint gene mdf-1 regulates germ cell proliferation in response to nutrition signals in C. elegans. EMBO J. (0261-4189) 2008 imex curation Watanabe S., Yamamoto TG., Kitagawa R. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Watanabe S., Yamamoto TG., Kitagawa R. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation q9ngt3_caeel mdf-2 Y69A2AR.30 CELE_Y69A2AR.30 protein protein caeel Caenorhabditis elegans MTDVKTQNAISLKGSAQLVKEFFHFGLNSILYQRALYPSDSFKREKKYGLTLWVAHEKKLQAFMDPLLQQVEYWLAKRQLKRLVMVISEVKTKEVVERWQFDIHTENLAEEGENAHRVKEEKKIRQEISDVIRQITASVSFLPLLEEPVSFDVLIYTGKDTQAPEDWTESGACLIQNSETVQLRSFSTSVHSVNTNVQYKADF 421359FE9346CC31 akt1_caeel Serine/threonine-protein kinase akt-1 akt-1 C12D8.10 Protein kinase B akt-1 protein protein caeel Caenorhabditis elegans MSMTSLSTKSRRQEDVVIEGWLHKKGEHIRNWRPRYFMIFNDGALLGFRAKPKEGQPFPEPLNDFMIKDAATMLFEKPRPNMFMVRCLQWTTVIERTFYAESAEVRQRWIHAIESISKKYKGTNANPQEELMETNQQPKIDEDSEFAGAAHAIMGQPSSGHGDNCSIDFRASMISIADTSEAAKRDKITMEDFDFLKVLGKGTFGKVILCKEKRTQKLYAIKILKKDVIIAREEVAHTLTENRVLQRCKHPFLTELKYSFQEQHYLCFVMQFANGGELFTHVRKCGTFSEPRARFYGAEIVLALGYLHRCDIVYRDMKLENLLLDKDGHIKIADFGLCKEEISFGDKTSTFCGTPEYLAPEVLDDHDYGRCVDWWGVGVVMYEMMCGRLPFYSKDHNKLFELIMAGDLRFPSKLSQEARTLLTGLLVKDPTQRLGGGPEDALEICRADFFRTVDWEATYRKEIEPPYKPNVQSETDTSYFDNEFTSQPVQLTPPSRSGALATVDEQEEMQSNFTQFSFHNVMGSINRIHEASEDNEDYDMG 17FEDD1109926950 g5efm0_caeel mdf-1 C50F4.11 CELE_C50F4.11 protein protein caeel Caenorhabditis elegans MNYDEDIVDEDEYEESEATMLFAEEIKKQFKREFPLKAETEKKLKQATFRRHAPVEARKINFDMTLSPVAPIELASAKKEKESAQRQLVTLREDHERMKQMMQTNQAKLAEKTIDLETNREKMLELQEQVELLKQERDDTIAECNRNVDIWTAFGKKYYTWYSMANTQLESVKLYIDNDGKFENDEEVTRLNAVPRQMYRALEQFDYDDETVEELGSGSLLEYEGVSFATRRPPSPETEREIARADQSAANFTLPQSNFTLLEDSNNTIMPEDQTMMTDGCIANRSLIDYEKDEKIQRLLLENSVLKDRLNVSSGRAERSMIFEERNRTLEFEKKALHKQLDSTFSEIEAIRIGQAGNLFNIDEKIPSSSDNSAKQLQLIDRITQLITKNNQLEKDFEAATSRMTKVMRESTDCARRNERLEDAFSSERVRSQDLENEKSRLSEQLELSNNELEKVKKQLEESQSQLDEVLSMTLTVPASEPASLPAPTDAGNSTQIFHMASNPLQDAHNEFQASESRKRKLTDAPAGDQWREQEFAELEKRLYDCESEKKVLESSYNLHKELSSKFRQVCIALTGLQIKLKDADEGICTVQSEYEGGSAQQFVFKYFYGTPRIDMLDVSCESTTEMLRKWEPLMKKYIGDRNSIPAFLAAMTLQLEQDRDFDETMHERTHTFSVLHED C65E3FD0BE484887 gsk3_caeel Glycogen synthase kinase-3 gsk-3 sgg-1 Y18D10A.5 protein protein caeel Caenorhabditis elegans MNKQLLSCSLKSGKQVTMVVASVATDGVDQQVEISYYDQKVIGNGSFGVVFLAKLSTTNEMVAIKKVLQDKRFKNRELQIMRKLNHPNIVKLKYFFYSSGEKKDELYLNLILEYVPETVYRVARHYSKQRQQIPMIYVKLYMYQLLRSLAYIHSIGICHRDIKPQNLLIDPESGVLKLCDFGSAKYLVRNEPNVSYICSRYYRAPELIFGATNYTNSIDVWSAGTVMAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIQSMNPNYKEFKFPQIKAHPWNKVFRVHTPAEAIDLISKIIEYTPTSRPTPQAACQHAFFDELRNPDARLPSGRPLPTLEMDGPMGTGEVSTTSGDVAGPSA ABDD2F49CC475BF5 akt_1-mdf_1 2 mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6543489: original sequence: 512-531 : FQASESRKRKLTDAPAGDQ G5EFM0:p.Thr523Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:08:08 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:56:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr523ala' Tue Jun 30 19:55:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr523Ala' range MINT-6543494: original sequence: 523-523 : QASESRKRKLTDAPAGDQWR phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain resulting-ptm range MINT-6543491: original sequence: 523-523 : QASESRKRKLTDAPAGDQWR akt-1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified phosphorylation phosphorylation reaction phosphorylation f4a sf6a mint akt_1-gsk_3 2 gsk-3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified akt-1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component in vitro translated in vitro translated protein in vitro translated phosphorylation phosphorylation reaction phosphorylation f4a sf4a mint akt_1-mdf_1-1 2 akt-1 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range MINT-6543505: original sequence: 661-769 : DFDETMHERTHTFSVLHED [EBI-7823042]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 769-769, sequence length 679 [EBI-7823042]661-769 G5EFM0:p.Thr672Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:50:59 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:15:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr672ala' Tue Jun 30 17:42:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr672Ala' range MINT-6543501: original sequence: 672-672 : FDETMHERTHTFSVLHE phosphorylated phosphorylated residue phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain resulting-ptm range MINT-6543503: original sequence: 672-672 : FDETMHERTHTFSVLHE phosphorylation phosphorylation reaction phosphorylation f4a sf6a mint mdf_2-mdf_1-1 3 mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G5EFM0:p.Thr523Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D Tue Jul 12 10:08:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:54:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr523asp' Tue Jun 30 16:55:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr523Asp' range MINT-6543530: original sequence: 523-523 : QASESRKRKLTDAPAGDQWR mdf-2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4e mint mdf_2-mdf_1-2 3 mdf-2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell G5EFM0:p.Thr523Ala mutation disrupting interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:06:25 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:01:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr523ala' Tue Jun 30 17:48:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr523Ala' range MINT-6543544: original sequence: 523-523 : QASESRKRKLTDAPAGDQWR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4e mint mdf_2-mdf_1-3 3 mdf-2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell G5EFM0:p.[Thr523Asp;Thr672Asp] mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D certain certain sequence position certain certain certain sequence position certain T D Tue Jul 12 10:06:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:40:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr523asp' Tue Jun 30 17:40:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr523Asp;Thr672Asp]' range MINT-6543554: original sequence: 523-523 : QASESRKRKLTDAPAGDQWR tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4e mint mdf_2-mdf_1-4 3 mdf-2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined G5EFM0:p.Thr672Asp mutation decreasing interaction mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T D Tue Jul 12 10:49:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 17:03:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr672asp' Tue Jun 30 16:50:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr672Asp' range MINT-6543575: original sequence: 672-672 : FDETMHERTHTFSVLHE physical association physical association f4e mint mdf_2-mdf_1-5 3 mdf-1 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell G5EFM0:p.Thr672Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:14:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:41:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr672ala' Tue Jun 30 17:11:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr672Ala' range MINT-6543587: original sequence: 672-672 : FDETMHERTHTFSVLHE tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mdf-2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4e mint mdf_1-mdf_2 1 mdf-2 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell mdf-1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4d mint