IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Characterization of Arabidopsis and Rice DWD Proteins and Their Roles as Substrate Receptors for CUL4-RING E3 Ubiquitin Ligases. Characterization of Arabidopsis and Rice DWD Proteins and Their Roles as Substrate Receptors for CUL4-RING E3 Ubiquitin Ligases. Plant Cell (1040-4651) 2008 imex curation Lee JH., Terzaghi W., Gusmaroli G., Charron JB., Yoon HJ., Chen H., He YJ., Xiong Y., Deng XW. Transgenic arabidopsis plants (ecotype Columbia) with inactive endogenous DDB1a expression were transformed with an expression construct containing FLAG tagged DDB1a or Cullin 4 protein. xingwang.deng@yale.edu 17-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lee JH., Terzaghi W., Gusmaroli G., Charron JB., Yoon HJ., Chen H., He YJ., Xiong Y., Deng XW. Transgenic arabidopsis plants (ecotype Columbia) with inactive endogenous DDB1a expression were transformed with an expression construct containing FLAG tagged DDB1a or Cullin 4 protein. xingwang.deng@yale.edu Accepted 2008-MAR-21 by ORCHARD. 17-April-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2008 orchard Only protein-protein interactions imex curation Characterization of Arabidopsis and Rice DWD Proteins and Their Roles as Substrate Receptors for CUL4-RING E3 Ubiquitin Ligases. Characterization of Arabidopsis and Rice DWD Proteins and Their Roles as Substrate Receptors for CUL4-RING E3 Ubiquitin Ligases. Plant Cell (1040-4651) 2008 imex curation Lee JH., Terzaghi W., Gusmaroli G., Charron JB., Yoon HJ., Chen H., He YJ., Xiong Y., Deng XW. Transgenic arabidopsis plants (ecotype Columbia) with inactive endogenous DDB1a expression were transformed with an expression construct containing FLAG tagged DDB1a or Cullin 4 protein. xingwang.deng@yale.edu 17-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lee JH., Terzaghi W., Gusmaroli G., Charron JB., Yoon HJ., Chen H., He YJ., Xiong Y., Deng XW. Transgenic arabidopsis plants (ecotype Columbia) with inactive endogenous DDB1a expression were transformed with an expression construct containing FLAG tagged DDB1a or Cullin 4 protein. xingwang.deng@yale.edu Accepted 2008-MAR-21 by ORCHARD. 17-April-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2008 orchard Only protein-protein interactions imex curation Characterization of Arabidopsis and Rice DWD Proteins and Their Roles as Substrate Receptors for CUL4-RING E3 Ubiquitin Ligases. Characterization of Arabidopsis and Rice DWD Proteins and Their Roles as Substrate Receptors for CUL4-RING E3 Ubiquitin Ligases. Plant Cell (1040-4651) 2008 imex curation Lee JH., Terzaghi W., Gusmaroli G., Charron JB., Yoon HJ., Chen H., He YJ., Xiong Y., Deng XW. Transgenic arabidopsis plants (ecotype Columbia) with inactive endogenous DDB1a expression were transformed with an expression construct containing FLAG tagged DDB1a or Cullin 4 protein. xingwang.deng@yale.edu 17-April-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee JH., Terzaghi W., Gusmaroli G., Charron JB., Yoon HJ., Chen H., He YJ., Xiong Y., Deng XW. Transgenic arabidopsis plants (ecotype Columbia) with inactive endogenous DDB1a expression were transformed with an expression construct containing FLAG tagged DDB1a or Cullin 4 protein. xingwang.deng@yale.edu Accepted 2008-MAR-21 by ORCHARD. 17-April-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2008 orchard Only protein-protein interactions imex curation ddb1a_arath DNA damage-binding protein 1a DDB1A C6L9.100 At4g05420 UV-damaged DNA-binding protein 1a protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSWNYVVTAHKPTSVTHSCVGNFTSPQELNLIVAKCTRIEIHLLTPQGLQPMLDVPIYGRIATLELFRPHGEAQDFLFIATERYKFCVLQWDPESSELITRAMGDVSDRIGRPTDNGQIGIIDPDCRLIGLHLYDGLFKVIPFDNKGQLKEAFNIRLEELQVLDIKFLFGCAKPTIAVLYQDNKDARHVKTYEVSLKDKDFVEGPWSQNSLDNGADLLIPVPPPLCGVLIIGEETIVYCSASAFKAIPIRPSITKAYGRVDVDGSRYLLGDHAGMIHLLVITHEKEKVTGLKIELLGETSIASTISYLDNAVVFVGSSYGDSQLVKLNLHPDAKGSYVEVLERYINLGPIVDFCVVDLERQGQGQVVTCSGAFKDGSLRVVRNGIGINEQASVELQGIKGMWSLKSSIDEAFDTFLVVSFISETRILAMNLEDELEETEIEGFLSQVQTLFCHDAVYNQLVQVTSNSVRLVSSTTRELRDEWHAPAGFTVNVATANASQVLLATGGGHLVYLEIGDGKLTEVQHALLEYEVSCLDINPIGDNPNYSQLAAVGMWTDISVRIFSLPELTLITKEQLGGEIIPRSVLLCAFEGISYLLCALGDGHLLNFQMDTTTGQLKDRKKVSLGTQPITLRTFSSKSATHVFAASDRPTVIYSSNKKLLYSNVNLKEVSHMCPFNSAAFPDSLAIAREGELTIGTIDDIQKLHIRTIPLGEHARRICHQEQTRTFGICSLGNQSNSEESEMHFVRLLDDQTFEFMSTYPLDSFEYGCSILSCSFTEDKNVYYCVGTAYVLPEENEPTKGRILVFIVEDGRLQLIAEKETKGAVYSLNAFNGKLLAAINQKIQLYKWMLRDDGTRELQSECGHHGHILALYVQTRGDFIVVGDLMKSISLLLYKHEEGAIEERARDYNANWMSAVEILDDDIYLGAENNFNLLTVKKNSEGATDEERGRLEVVGEYHLGEFVNRFRHGSLVMRLPDSEIGQIPTVIFGTVNGVIGVIASLPQEQYTFLEKLQSSLRKVIKGVGGLSHEQWRSFNNEKRTAEARNFLDGDLIESFLDLSRNKMEDISKSMNVQVEELCKRVEELTRLH DIP protein Q9M0V3 original sequence version: 82 79071E5BC62A197E eif3i_arath Eukaryotic translation initiation factor 3 subunit I TIF3I1 T3F17.7 At2g46280 Eukaryotic translation initiation factor 3 subunit 2 eIF-3-beta eIF3 p36 TGF-beta receptor-interacting protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPILMKGHERPLTFLRYNREGDLLFSCAKDHTPTLWFADNGERLGTYRGHNGAVWCCDVSRDSSRLITGSADQTAKLWDVKSGKELFTFKFNAPTRSVDFAVGDRLAVITTDHFVDRTAAIHVKRIAEDPEEQDAESVLVLHCPDGKKRINRAVWGPLNQTIVSGGEDKVIRIWDAETGKLLKQSDEEVGHKKDITSLCKAADDSHFLTGSLDKTAKLWDMRTLTLLKTYTTVVPVNAVSLSPLLNHVVLGGGQDASAVTTTDHRAGKFEAKFYDKILQEEIGGVKGHFGPINALAFNPDGKSFSSGGEDGYVRLHHFDSDYFNIKI 4ABFE9866A09CFAF msi3_arath WD-40 repeat-containing protein MSI3 MSI3 M4E13.110 At4g35050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAEEGKDEAGLDQVEEEFSIWKRNTPFLYDLMISHPLEWPSLTLHWVPSTPIPYSKDPYFAVHKLILGTHTSGGAQDFLMVADVVIPTPDAEPGLGGRDQEPIVPKVEIKQKIRVDGEVNRARCMPQKPTLVGAKTSGSEVFLFDYARLSGKPQTSECDPDLRLMGHEQEGYGLAWSSFKEGYLLSGSQDQRICLWDVSATATDKVLNPMHVYEGHQSIIEDVAWHMKNENIFGSAGDDCQLVIWDLRTNQMQHQVKVHEREINYLSFNPFNEWVLATASSDSTVALFDLRKLTAPLHVLSKHEGEVFQVEWDPNHETVLASSGEDRRLMVWDINRVGDEQLEIELDAEDGPPELLFSHGGHKAKISDFAWNKDEPWVISSVAEDNSLQVWQMAESIYREDDEDEDDDDEGNQNAQHSNENQK D83E2B4913468A0A q8h177_arath At1g65030 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSIIAGSYERFIWGFKLKPTKHDAESQTLTLSPLFSYPSHISPITTVACSGPAAASGGSDDTIHLYDLPSASSLGSLLDHNHAASITALSFYTPSSLSFPRNLISAAADGSVAIFDTDPFVLLKSFRPHKKAVNDLAIHPSGKLALAVYRDEFFAMLNLVRGKRSFCCRLGHEASLVKFDPSGERFYMVVSNKVGVHQSEDAKLLLELENPSRKRILCATPGESGTLFTGGEDRAITAWDTNSGKLAYSIEDAHPARIKGIVVFTRNDSDGSLEDPYLIGSASSDGIIRVWDVRMAAKENTKPLAETNTKSRLTCLAGSALKSMRRPQIGKQEPQKVDEEHEDSE 977CC8221F0A3756 q9m1e5_arath F9K21.200 At3g45620/F9K21_200 At3g45620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARPRRRNTEIGDGFTEIFNREIGFSHPITISRRISASEGRVKKLDLYGKLNGHEGCVNAVEFNSTGDVLVSGSDDRQIMLWNWLSGSRKLSYPSGHCENVFQTKFIPFTDDRTIITSGADGQVRLGQILENGKVETKRLGRHHGRVYKLAVLPGDPNVFYSCGEDGFVQHFDIRSNSATMVLYSSPFTQGCRRHHSSSRIRLNSIAIDPRNSYYLAVGGSDEYARVYDTRRVQLAPVCRHVLPDAPVNTFCPRHLRETNSVHITGLAYSKAGELLVSYNDELIYLFEKNMGYGSSPVSVSPEKLQEMEEPQVYIGHRNAQTVKGVNFFGPNDEYVTSGSDCGHIFIWKKKGGKLVRAMVGDRRVVNQLESHPHIPLLASCGIEKSVKLWTPMSNDVLSLPEKIDKVMELNRVGREDQSRVTLTPDVIMHVLRLQRRQTSAFTERRYVSTDIGSDEGNDARFIASLVANDDESSDRECTVS 0FBBA09588C79A94 rae1_arath Protein RAE1 RAE1 RNA export factor 1 F23A5.2 At1g80670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATFGAPATANSNPNKSYEVTPSPADSISSLSFSPRADILVATSWDNQVRCWEISRSGASLASAPKASISHDQPVLCSAWKDDGTTVFSGGCDKQAKMWPLLSGGQPVTVAMHEGPIAAMAWIPGMNLLATGSWDKTLKYWDTRQQNPVHTQQLPDKCYTLSVKHPLMVVGTADRNLIVFNLQNPQTEFKRIQSPLKYQTRCVTAFPDQQGFLVGSIEGRVGVHHLDDSQQSKNFTFKCHRDGNDIYSVNSLNFHPVHGTFATAGSDGAFNFWDKDSKQRLKAMSRCNQPIPCSSFNHDGSIYAYAACYDWSKGAENHNPATAKSSIFLHLPQESEVKAKPRVGATGRK F1780EF3258C5632 fy_arath Flowering time control protein FY FY T6I14.10 At5g13480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYAGGDMHRGSQMPQPPMMRQSSASSTNINPDYHHPSGPFDPNVDSFGAKRMRKHTQRRAVDYTSTVVRYIQARTWQRDSRDRTTLQPTPAAAVDMLPTVAYSDNPSTSFAAKFVHASLNKNRCSINRVLWTPSGRRLITGSQSGEFTLWNGQSFNFEMILQAHDQPIRSMVWSHNENYMVSGDDGGTLKYWQNNMNNVKANKTAHKESIRDLSFCKTDLKFCSCSDDTTVKVWDFTKCVDESSLTGHGWDVKSVDWHPTKSLLVSGGKDQLVKLWDTRSGRELCSLHGHKNIVLSVKWNQNGNWLLTASKDQIIKLYDIRTMKELQSFRGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHENPQIEIPNAHDNSVWDLAWHPIGYLLCSGSNDHTTKFWCRNRPADNPRDVLMQNQGYNEQGFGRQPDNFQPSEASPIPGAFVPGLTRNEGTIPGIGIAMPFDASSQGDHKQPLPGSMALGAPPLPPGPHPSLLGSGQQQGYQQQQQHQGHPQQMLPMPNMPHHQLPPSSHMPLHPHHLPRPMQMPPHGHMPPPSMPMSHQMPGSMGMQGGMNPQMSQSHFMGAPSGVFQGQPNSGGPQMYPQGRGGFNRPQMIPGYNNPFQQQQQPPLPPGPPPNNNQQHQ DIP protein Q6NLV4 original sequence version: 79 74569D2178BEA5C7 q8w4d9_arath DDB1- and CUL4-associated factor 13 F20O9.130 WD repeat and SOF domain-containing protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIKTLSRSVDEYTRERSQDLQRVFHNFDPSLRPMEKAVEYQRALTAAKLEKIFARPFVGAMDGHRDGVSCMAKNPNYLKGIFSASMDGDIRLWDISSRRTVCQFPGHQGAVRGLTASTDGNVLVSCGTDCTVRLWNVPRPSLEDSSISSENFIEPSATYVWKNAFWAVDHQFEGDLFATAGAQLDIWNHNRSQPVQSFQWGTDSVISVRFNPGEPNLLATSASDRSITIYDLRLSSAARKIIMMTKTNSIAWNPMEPMNLTAANEDGSCYSFDGRKLDEAKCVHKDHVSAVMDIDFSPTGREFVTGSYDRSVRIFPYNGGHSREIYHTKRMQRVFCVKYSCDATYVISGSDDTNLRLWKAKASEQLGFILPREQKKHEYNEAVKNRYKHLSEVKRIVRHRHLPKPIYKAMGIIRTVNDSKRRKEARRKAHSAPGTVVTAPLRKRKIIKEVE 56DBC7901923B3B7 cul4_arath Cullin-4 CUL4 MDE13.3 At5g46210 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLPTKRSTFSAASASDDSSYSSPPMKKAKNDLHHSPQHPNTADKVVGFHMEEDPTPAAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLESLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCDQMLMIRSIALTLDRKYVIQNPNVRSLWEMGLQLFRKHLSLAPEVEQRTVKGLLSMIEKERLAEAVNRTLLSHLLKMFTALGIYMESFEKPFLEGTSEFYAAEGMKYMQQSDVPEYLKHVEGRLHEENERCILYIDAVTRKPLITTVERQLLERHILVVLEKGFTTLMDGRRTEDLQRMQTLFSRVNALESLRQALSSYVRKTGQKIVMDEEKDKDMVQSLLDFKASLDIIWEESFYKNESFGNTIKDSFEHLINLRQNRPAELIAKFLDEKLRAGNKGTSEEELESVLEKVLVLFRFIQGKDVFEAFYKKDLAKRLLLGKSASIDAEKSMISKLKTECGSQFTNKLEGMFKDIELSKEINESFKQSSQARTKLPSGIEMSVHVLTTGYWPTYPPMDVKLPHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKADFSKGKKELAVSLFQAVVLMLFNDAMKLSFEDIKDSTSIEDKELRRTLQSLACGKVRVLQKNPKGRDVEDGDEFEFNDEFAAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQIDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLEREKSNPQIYNYLA DIP protein Q8LGH4 original sequence version: 63 6C1E21BFCB9141DF gbb_arath Guanine nucleotide-binding protein subunit beta GB1 T4L20.40 At4g34460 transducin AGB1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVSELKERHAVATETVNNLRDQLRQRRLQLLDTDVARYSAAQGRTRVSFGATDLVCCRTLQGHTGKVYSLDWTPERNRIVSASQDGRLIVWNALTSQKTHAIKLPCAWVMTCAFSPNGQSVACGGLDSVCSIFSLSSTADKDGTVPVSRMLTGHRGYVSCCQYVPNEDAHLITSSGDQTCILWDVTTGLKTSVFGGEFQSGHTADVLSVSISGSNPNWFISGSCDSTARLWDTRAASRAVRTFHGHEGDVNTVKFFPDGYRFGTGSDDGTCRLYDIRTGHQLQVYQPHGDGENGPVTSIAFSVSGRLLFAGYASNNTCYVWDTLLGEVVLDLGLQQDSHRNRISCLGLSADGSALCTGSWDSNLKIWAFGGHRRVI DIP protein P49177 original sequence version: 63 06673A2F707A2F44 thoc6_arath THO complex subunit 6 THO6 DWA1 Protein DWD HYPERSENSITIVE TO ABA 1 THOC6 WD repeat-containing protein DWA1 F27F23.25 At2g19430 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYGDATNWNEDEYRESILKEREIETRTVFRTAWAPPARISNPDAFVVASSDGTLAFHSLNSLVSQSASFGYSKGQDVMVAEPERVVRAHEGPAYDVKFYGEDEDALLLSCGDDGRVRGWKWREFAESDVSLHLKENHLKPLLELINPQHKGPWGALSPMPEINAMSVDPQSGSVFTAAGDSCAYCWDVESGKIKMTFKGHSDYLHTVVSRSSASQILTGSEDGTARIWDCKTGKCVKVIGSQDKKSRLRVSSMALDGSESWLVCGQGKNLALWNLPASECVQTIPIPAHVQDVMFDEKQILTVGAEPLLRRFDLNGALLSQIHCAPCSVFSISLHPAGVVAVGGYGGIVDVISQFGSHLCTFRSSSL 688A76897C323589 prl1_arath Protein pleiotropic regulatory locus 1 PRL1 At4g15900 dl3990w MAC2 MOS4-associated complex protein 2 FCAALL.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPAPTTEIEPIEAQSLKKLSLKSLKRSLELFSPVHGQFPPPDPEAKQIRLSHKMKVAFGGVEPVVSQPPRQPDRINEQPGPSNALSLAAPEGSKSTQKGATESAIVVGPTLLRPILPKGLNYTGSSGKSTTIIPANVSSYQRNLSTAALMERIPSRWPRPEWHAPWKNYRVIQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIEQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRSYHGHLSGVYCLALHPTLDVLLTGGRDSVCRVWDIRTKMQIFALSGHDNTVCSVFTRPTDPQVVTGSHDTTIKFWDLRYGKTMSTLTHHKKSVRAMTLHPKENAFASASADNTKKFSLPKGEFCHNMLSQQKTIINAMAVNEDGVMVTGGDNGSIWFWDWKSGHSFQQSETIVQPGSLESEAGIYAACYDNTGSRLVTCEADKTIKMWKEDENATPETHPINFKPPKEIRRF 604D3E6FCDA8A998 vip3_arath WD repeat-containing protein VIP3 VIP3 Protein BOUQUET-1 Protein SKI8 homolog Protein VERNALIZATION INDEPENDENCE 3 Protein ZWERGERL SKI8 F27B13.70 At4g29830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKLAGLKSIENAHEDSVWAATWVPATEDRPALLLTGSLDETVKLWRPDELDLVRTNTGHSLGVAALAAHPSGIIAASSSIDSFVRVFDVDTNATIAVLEAPPSEVWGMQFEPKGTILAVAGGSSASVKLWDTASWRLISTLSIPRPDAPKPSDKTSSKKFVLSVAWSPNGKRLACGSMDGTICVFDVDRSKLLHQLEGHNMPVRSLVFSPVDPRVLFSGSDDGHVNMHDAEGKTLLGSMSGHTSWVLSVDASPDGGAIATGSSDRTVRLWDLKMRAAIQTMSNHNDQVWSVAFRPPGGTGVRAGRLASVSDDKSVSLYDYS 0C71AB5E2B6968F3 ddb1a-at2g19430 3 14 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-msi3 3 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at1g80670 3 4 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at4g29830 3 16 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-trif3l1 3 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-gb1 3 4 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at1g65030 3 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at4g28450 3 4 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at3g45620 3 4 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at5g13480 3 10 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-prl1 3 15 unspecified role unspecified role prey prey Q42384:p.[Arg290His;Arg332His] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R H certain certain sequence position certain certain certain sequence position certain R H Fri Jul 22 11:00:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg332his,arg290his' Wed May 02 15:56:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg290his,arg332his' Tue Jun 30 20:05:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg290His;Arg332His]' 4 unspecified role unspecified role bait bait physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-cullin 3 4 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Figure 3 Interactions between DDB1a and Arabidopsis DWD Proteins Detected by Yeast Two-Hybrid Assays. ddb1a-at5g13480-1 2 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association Figure 4A DWD proteins PRL1 (At4g15900), TRIP-1 (At2g46280), and FY (At5g13480) were efficiently retrieved from the DDB1b immunocomplex together with CUL4, a positive control for DDB1 binding, whereas the negative control RPN6, 26S proteasome regulatory subunit 6 (At1g29150, subunit 9 of the 19S proteasome) was not. ddb1a-cullin-1 2 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association Figure 5A Coimmunoprecipitation of DDB1b and CUL4 in FLAG-DDB1b/ddb1a transgenic plants. cullin-prl1 2 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 4B Moreover, PRL1 was efficiently retrieved from the CUL4 immunocomplex in FLAG-CUL4 transgenic lines, whereas RPN6 was not, showing that PRL1 associates with CUL4 in vivo ddb1a-at3g45620-1 1 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5B Since antibodies were not available for the otherDWDproteins tested in Figure 3, we generated MYC-tagged constructs for the DWD proteins At3g45620, At4g35050, At1g65030, At2g19430, and At4g29830 and transformed them into FLAG-DDB1b/ddb1a lines. As shown in Figure 5, all of these proteins were coimmunoprecipitated with FLAG-DDB1b, with the exception of At1g04140, ddb1a-msi3-1 1 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5B Since antibodies were not available for the otherDWDproteins tested in Figure 3, we generated MYC-tagged constructs for the DWD proteins At3g45620, At4g35050, At1g65030, At2g19430, and At4g29830 and transformed them into FLAG-DDB1b/ddb1a lines. As shown in Figure 5, all of these proteins were coimmunoprecipitated with FLAG-DDB1b, with the exception of At1g04140, ddb1a-at1g65030-1 1 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5B Since antibodies were not available for the otherDWDproteins tested in Figure 3, we generated MYC-tagged constructs for the DWD proteins At3g45620, At4g35050, At1g65030, At2g19430, and At4g29830 and transformed them into FLAG-DDB1b/ddb1a lines. As shown in Figure 5, all of these proteins were coimmunoprecipitated with FLAG-DDB1b, with the exception of At1g04140, ddb1a-at4g29830-1 1 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5B Since antibodies were not available for the otherDWDproteins tested in Figure 3, we generated MYC-tagged constructs for the DWD proteins At3g45620, At4g35050, At1g65030, At2g19430, and At4g29830 and transformed them into FLAG-DDB1b/ddb1a lines. As shown in Figure 5, all of these proteins were coimmunoprecipitated with FLAG-DDB1b, with the exception of At1g04140, ddb1a-at2g19430-1 1 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 5B Since antibodies were not available for the otherDWDproteins tested in Figure 3, we generated MYC-tagged constructs for the DWD proteins At3g45620, At4g35050, At1g65030, At2g19430, and At4g29830 and transformed them into FLAG-DDB1b/ddb1a lines. As shown in Figure 5, all of these proteins were coimmunoprecipitated with FLAG-DDB1b, with the exception of At1g04140,