MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. EMBO J. (0261-4189) 2007 imex curation Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. EMBO J. (0261-4189) 2007 imex curation Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. EMBO J. (0261-4189) 2007 imex curation Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. EMBO J. (0261-4189) 2007 imex curation Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. EMBO J. (0261-4189) 2007 imex curation Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1. EMBO J. (0261-4189) 2007 imex curation Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. Only protein-protein interactions human-du_145 Homo sapiens DU-145 prostate cancer cell line du_145 DU-145 Human prostate carcinoma established from the tumor tissue removed from the metastatic central nervous system lesion of a 69-year-old man with prostate carcinoma in 1975 confirmed as human with IEF of AST, MDH, NP fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Cinar B., Fang PK., Lutchman M., Di Vizio D., Adam RM., Pavlova N., Rubin MA., Yelick PC., Freeman MR. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation stk4_human Serine/threonine-protein kinase 4 STK4 MST1 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Serine/threonine-protein kinase Krs-2 KRS2 protein protein human Homo sapiens Human METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF 150758EBC5F77D5C akt1_mouse RAC-alpha serine/threonine-protein kinase Akt1 Akt Rac RAC-PK-alpha AKT1 kinase Proto-oncogene c-Akt Protein kinase B Thymoma viral proto-oncogene Protein kinase B alpha protein protein mouse Mus musculus Mouse MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWATAIQTVADGLKRQEEETMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA DIP protein P31750 original sequence version: 125 DIP protein P31750 original sequence version: 168 DIP protein P31750 original sequence version: 88 98DF28E5EFE03730 akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA DIP protein P31749 original sequence version: 184 DIP protein P31749 original sequence version: 168 DIP protein P31749 original sequence version: 102 DIP protein P31749 original sequence version: 110 DIP protein P31749 original sequence version: 160 DIP protein P31749 original sequence version: 136 DIP protein P31749 original sequence version: 175 DIP protein P31749 original sequence version: 201 DIP protein P31749 original sequence version: 166 DIP protein P31749 original sequence version: 178 DIP protein P31749-1 original sequence version: 194 DIP protein P31749 original sequence version: 106 DIP protein P31749 original sequence version: 141 6EAFF4F8AD436714 akt1-stk4 4 AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell MST1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association F1C F2A In this experiment has been used a myristoylated form of AKT1. homomint mint stk4-akt1 4 AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell MST1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association F1C F2A In this experiment has been used a myristoylated form of AKT1. homomint mint akt1-stk4-1 4 MST1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q13043:p.Lys59Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:08:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:20:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys59arg' Tue Jun 30 17:06:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys59Arg' range MINT-6175091: original sequence: 59-59 : HKETGQIVAIKQVPVESDLQ AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association F2D In this experiment has been used a myristoylated form of AKT1. homomint mint akt1-stk4-2 3 AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MST1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association F2B homomint mint stk4-akt1-1 3 MST1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell t7 tagged t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2B homomint mint akt1-stk4-3 3 MST1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P31749:p.Pro424Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:13:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:17:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro424ala' Tue Jun 30 19:27:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro424Ala' range MINT-6365097: original sequence: 424-424 : QHVYEKKLSPPFKPQVTSET P31749:p.Pro427Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Tue Jul 12 10:53:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:53:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro427ala' Tue Jun 30 17:33:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro427Ala' range MINT-6175151: original sequence: 427-427 : YEKKLSPPFKPQVTSETDTR physical association physical association F3B homomint mint stk4-akt1-2 3 MST1 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6175216: original sequence: 411-480 : IVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGT physical association physical association F3C F3E homomint mint akt1-stk4-4 1 AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level MST1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association FIB F1C homomint mint akt1-stk4-5 2 AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified MST1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F1E homomint mint stk4-akt1-3 2 AKT1 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified MST1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction F1F homomint mint akt1-stk4-6 6 AKT1 9 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell MST1 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization F4B In this experiment has been used a myristoylated form of AKT1. homomint mint akt1-stk4-7 6 MST1 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region c-term range C-terminal range c-term range c-term range C-terminal range c-term range AKT1 9 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4C homomint mint akt1-stk4-8 6 MST1 7 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell binding site binding region binding-associated region binding region n-term range n-terminal range n-term range n-term range n-terminal range n-term range AKT1 9 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4C homomint mint akt1-stk4-9 5 AKT1 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MST1 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified physical association physical association F1D In this experiment has been used a myristoylated form of AKT1. homomint mint