MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it p40phox as an alternative organizer to p47phox in Nox2 activation: a new mechanism involving an interaction with p22phox. p40phox as an alternative organizer to p47phox in Nox2 activation: a new mechanism involving an interaction with p22phox. FEBS Lett. (0014-5793) 2007 imex curation Tamura M., Shiozaki I., Ono S., Miyano K., Kunihiro S., Sasaki T. tamura@eng.ehime-u.ac.jp 2009-01-08 Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Tamura M., Shiozaki I., Ono S., Miyano K., Kunihiro S., Sasaki T. tamura@eng.ehime-u.ac.jp FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation cy24a_human Cytochrome b-245 light chain p22 phagocyte B-cytochrome Neutrophil cytochrome b 22 kDa polypeptide p22-phox Cytochrome b(558) alpha chain Cytochrome b558 subunit alpha Superoxide-generating NADPH oxidase light chain subunit CYBA protein protein human Homo sapiens Human MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVFVCLLEYPRGKRKKGSTMERWGQKYMTAVVKLFGPFTRNYYVRAVLHLLLSVPAGFLLATILGTACLAIASGIYLLAAVRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV DIP protein P13498 original sequence version: 99 428427AD19398240 ncf1_human Neutrophil cytosol factor 1 NCF1 Neutrophil NADPH oxidase factor 1 47 kDa neutrophil oxidase factor p47-phox NCF-47K 47 kDa autosomal chronic granulomatous disease protein Nox-organizing protein 2 Nox organizer 2 SH3 and PX domain-containing protein 1A NOXO2 SH3PXD1A protein protein human Homo sapiens Human MGDTFIRHIALLGFEKRFVPSQHYVYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENRQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKDGKSTATDITGPIILQTYRAIANYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWWVIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAYRRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKRKLASAV 3D91EDC99A1B6417 ncf4_human Neutrophil cytosol factor 4 NCF4 Neutrophil NADPH oxidase factor 4 p40-phox SH3 and PX domain-containing protein 4 SH3PXD4 protein protein human Homo sapiens Human MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEGTVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQREDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP D82FE9E5BA12890B ncf4-cyba 1 p40phox 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q15080:p.Trp207Arg mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W R Tue Jul 12 10:51:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:24:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp207arg' Tue Jun 30 20:25:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp207Arg' range MINT-6175923: original sequence: 207-207 : IFLLSRINKDWLEGTVRGAT p22PR 2 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified P13498:p.Pro156Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P E Tue Jul 12 10:51:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:52:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro156glu' Tue Jun 30 16:16:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro156Glu' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6175928: original sequence: 149-166 : KQPPSNPPPRPPAEARK direct interaction direct interaction F7B F7C homomint mint ncf1-cyba-7 1 p47phox 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified p22PR 2 peptide synthesis peptide synthesis predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-6175934: original sequence: 149-166 : KQPPSNPPPRPPAEARK P13498:p.Pro156Glu mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P E Tue Jul 12 10:11:42 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 15:09:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro156glu' Tue Jun 30 19:14:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro156Glu' direct interaction direct interaction F7B F7C homomint mint