MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it SUMO-targeted ubiquitin ligases in genome stability. SUMO-targeted ubiquitin ligases in genome stability. EMBO J. (0261-4189) 2007 imex curation Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation SUMO-targeted ubiquitin ligases in genome stability. SUMO-targeted ubiquitin ligases in genome stability. EMBO J. (0261-4189) 2007 imex curation Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. 2009-01-08 Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation SUMO-targeted ubiquitin ligases in genome stability. SUMO-targeted ubiquitin ligases in genome stability. EMBO J. (0261-4189) 2007 imex curation Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation SUMO-targeted ubiquitin ligases in genome stability. SUMO-targeted ubiquitin ligases in genome stability. EMBO J. (0261-4189) 2007 imex curation Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. 2009-01-08 Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation nse6_schpo Non-structural maintenance of chromosome element 6 nse6 SPAC11E3.08c Core protein 1 cor1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNASNNISKFPDLDNSSKLIDHILDSDDSEELDELPDISSLVPSARAQSRKQYLKNDSSNSSTYRWNIDLLSSTATIDDSVAKRRKLAVQNLLQYDSTQTFQTGDEIDELIGKSVGSNVLNVLRSNPIYDDDLRYEYCSNSKARVPDWNTLKAECLKDNDLEFNEGIIPTTFGDLLSAKLVPLDIALSICSLQFFRSLGDTTCSEWIANLEKIFYSYKSSSNNLNQIVRFIFETTADMIGIDLAKRQVPIQLERTSASENLKSNLKIKVINFLKCCGTLYRFSDDTVRFEMIQDACRILIDNQVGSFCKWQFSQFMELPISLNPDFLISNIHKVSESPRVWVTILSSLSRSCQKFRKKIAFTLFVGKQSKNDDSDFSSLCQRLDEISASCNNDYTTLLYQIRTFGYAVDEKHFKTNERLECLLEKLRKIDLTISGSTDHLLLSRCEVKDCIHRLFMVLYYLNTNSAPELERIIESDLPNNNKQKDRYFKDKTSNLSMKENKSFSAKKVKKGKKKNKRQAYKR 36CF241DD74AF0F5 slx8_schpo E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 SPBC3D6.11c slx8 RING-dependent E3 ubiquitin-protein ligase slx8 RING finger protein slx8 Synthetic lethal of unknown function protein 8 RING-type E3 ubiquitin transferase slx8 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPAHKRDTNVRNLSAPYNIPSQSARVAAGNAAINRRRSSPVENSPGNGFPVSEDATDYPSGTTSENESLPLNRAPRSLREVASELAQEETLPVETSDLNIDVESEVFDLEDINFQNDADDINQRFTYNNHPASVENSLTNVNSIHAQPTTISDMIDLTDETSYDPRKQKFEQGKNPSTTNAEIEKEEPSKKQVVPSSQRLADYKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVICLEMMLGSQKKKS mint 310A0F1DB88EEECB rfp2_schpo E3 ubiquitin-protein ligase complex slx8-rfp subunit rfp2 rfp2 RING finger protein 2 RING-type E3 ubiquitin transferase rfp2 SPAC343.18 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNLHGLELPGRDQRLSPEVIDLTEDIEDDGADVSEVTLLDLTRIPEFQPRRRIRTSRNHLDANLSNVPTINSIPSPVTRPPVAVGGGIFYGARRTRNRSQTQRRTLLENGFRNSRKKAQDSSNSIAERVSPPPGFCYDVHPHNNIACAKCGNELVSDEKKSIFAAKCGHLFCSTCAKELRKKTVPCPVQHCRKRITKKFIFPLYL mint C4BF42106B1F55AF nse5_schpo Non-structural maintenance of chromosome element 5 SPBC651.10 nse5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNSALKAIIELCIEEDLLPKSLDVLEYLLSTTSIPIPACYIRMCITLLVHPEYPTSSNIQESCNWILQQVVENRSKINFDAWSFENDLSDNDMPKENYLKIFSNQCLFTQDVDYWDLIAYMSSRPPDLERWMSLMDIWLRILEIDAEENGSALMKKYMGEDLCELQDAIRICFSCFTLPQQTMESPFATSMSKAPAKTESRGSNSFEGTSRLANLGAKLLCLIWAMLPKGRFFVVHLTDAFHFLSKLDERFSKLNAKQQDLFFGNLGASNLRYCLSQYILMKGIGIGINIRHTRCEFTKQLTQLLPTSLPKNKIRQKLHLRAWVSFLGSALRESDRNFDKELFYTTLKQLYTMYQQTELVGIDRPMAILKDMLVLLDISKKLSLDKIV 5995E64A422FBBC9 rad60_schpo DNA repair protein rad60 rad60 SPBC1921.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDNLDEDDLAFFSKPIKKPPLNYAKQLIASSSDSEEESELDTNKQALEHINAQKNITHNENKSAEPLSRQSTILDADEGNQDVSDTTPNACLNEGRHSPKSAISCVTQPVSPVYNTRAAANLRNNSINSEAALSTTSSLLDDDFARRLEEIDRQVQEFEKSSSDMDVQIHTHKREIEEDDDNTSADVPLLKHSKSDHSTLYHSKSEFSTNEPVISVVLQLAVIGQRIPNSNISLPRDWEAPLFFKVKSNQQFRRVRIAYSERKKVDNVVLVFQNQRLWDYGTPKGAGMLKVDTRLVVHAYCHSDFISLKRIKELEVEKLSSVTEDSTAQTCKLITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFHERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVLD 5FF406D9FC791983 5FF406D9FC791983 rnf4_human E3 ubiquitin-protein ligase RNF4 SNURF RING finger protein 4 Small nuclear ring finger protein RNF4 RES4-26 RING-type E3 ubiquitin transferase RNF4 protein protein human Homo sapiens Human MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI E5E3AE4A9B28CF9D pmt3_schpo Ubiquitin-like protein pmt3/smt3 pmt3 smt3 ubl2 SPBC365.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGCTHLCL 11C860EBEA172FD2 nf2ip_human NFATC2-interacting protein Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein NFATC2IP NIP45 45 kDa NF-AT-interacting protein protein protein human Homo sapiens Human MAEPVGKRGRWSGGSGAGRGGRGGWGGRGRRPRAQRSPSRGTLDVVSVDLVTDSDEEILEVATARGAADEVEVEPPEPPGPVASRDNSNSDSEGEDRRPAGPPREPVRRRRRLVLDPGEAPLVPVYSGKVKSSLRLIPDDLSLLKLYPPGDEEEAELADSSGLYHEGSPSPGSPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG CA04220B4BF0B245 rfp1_schpo E3 ubiquitin-protein ligase complex slx8-rfp subunit rfp1 RING-type E3 ubiquitin transferase rfp1 rfp1 mug140 Meiotically up-regulated gene 140 protein RING finger protein 1 SPAC19A8.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQFNGSNGIDESSVIDLTRSPSPPVETSISSTNIIDLDAIPDDSFPSSPVLSPRRRRMNRRRNERSRNFPSNHLSYLEDMIYLGPQVSTRRSSSRRDLMGMIARTFPEFSSVNSLSPSLFQLIVNRMRFDAIHPEWTNGSDDEYFSNHFEESYDDFTSSLENIKQSYKPPGPPKSGFTRSFNNDTLMVCPRCQEPLGTSKSKEKSALWATKCGHVYCGSCAKVLKTSKRSQSKCLVNDCGRYLNTKNAMWELFY E47B9E2B35E573DA nse5-rfp1 3 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1A mint nse5-nse6-4 3 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint pmt3-rfp1 3 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint rfp1-pmt3-3 3 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain SIM range MINT-6169139: original sequence: 1-38 : MQFNGSNGIDESSVIDLTRSPSPPVETSISSTNIIDL 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B mint rfp1-rad60-1 3 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain SIM range MINT-6169145: original sequence: 1-38 : MQFNGSNGIDESSVIDLTRSPSPPVETSISSTNIIDL physical association physical association F5A mint rfp1-slx8-1 1 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint slx8-rfp1 1 13 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6169053: original sequence: 206-246 : CVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPV gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association SF1 domino mint rfp2-slx8-1 1 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F1B mint rad60-slx8 1 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5B mint nfatc2ip-rnf4 4 12 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-6169207: original sequence: 266-419 : PLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVW 10 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F6D Overexpression of SUMO increases this interaction. Overexpression of SUMO increases this interaction. homomint mint slx8-rfp1-1 2 13 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Slx-8 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association SF2B mint rfp2-slx8-2 2 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association SF2C mint rfp2-rfp1 2 13 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association SF2C The interaction is distroyed when slx8 is also overespressed. The interaction is distroyed when slx8 is also overespressed. mint