IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell (1040-4651) 2006 imex curation Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. The region given in the text as the CCT domain of COL15 is incorrect. It has been corrected in these entries. coupland@mpiz-koeln.mpg.de Accepted 2009-DEC-2 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 orchard Only protein-protein interactions imex curation CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell (1040-4651) 2006 imex curation Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de Accepted 2009-DEC-2 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 orchard Only protein-protein interactions imex curation CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell (1040-4651) 2006 imex curation Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. orchard Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de Accepted 2009-DEC-2 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 orchard Only protein-protein interactions imex curation CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell (1040-4651) 2006 imex curation Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. orchard Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. The authors concluded " coimmunoprecipitation of At HAP2a and GAD:CO was barely detectable (Figure 1A), suggesting that At HAP2a did not interact with GAD:CO or did so to a much lesser extent than At HAP3a and At HAP5a". Therefore interaction between CO and Hap2a were not curated. Details of the assay were obtained from a reference provided in the text. Note for some reason wenkle-2006-1 is already accepted. coupland@mpiz-koeln.mpg.de Accepted 2009-DEC-2 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 orchard Only protein-protein interactions imex curation CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. Plant Cell (1040-4651) 2006 imex curation Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. orchard Only protein-protein interactions arath-leaf Arabidopsis thaliana leaf leaf leaf fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de Accepted 2009-DEC-2 by ORCHARD. 23-Dec-2009: Contacted by JYOTI. Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 orchard Only protein-protein interactions imex curation col15_arath Zinc finger protein CONSTANS-LIKE 15 COL15 F13K9.15 At1g28050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSERVPCDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQICDNCGNEPVSVRCFTDNLILCQECDWDVHGSCSVSDAHVRSAVEGFSGCPSALELAALWGLDLEQGRKDEENQVPMMAMMMDNFGMQLDSWVLGSNELIVPSDTTFKKRGSCGSSCGRYKQVLCKQLEELLKSGVVGGDGDDGDRDRDCDREGACDGDGDGEAGEGLMVPEMSERLKWSRDVEEINGGGGGGVNQQWNATTTNPSGGQSSQIWDFNLGQSRGPEDTSRVEAAYVGKGAASSFTINNFVDHMNETCSTNVKGVKEIKKDDYKRSTSGQVQPTKSESNNRPITFGSEKGSNSSSDLHFTEHIAGTSCKTTRLVATKADLERLAQNRGDAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVRGRFVKASEAPYP 69BD074D994D996B nfyc5_arath Nuclear transcription factor Y subunit C-5 NFYC5 MBA10.4 At5g50490 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNNNNHQQPPKDNEQLKSFWSKGMEGDLNVKNHEFPISRIKRIMKFDPDVSMIAAEAPNLLSKACEMFVMDLTMRSWLHAQESNRLTIRKSDVDAVVSQTVIFDFLRDDVPKDEGEPVVAAADPVDDVADHVAVPDLNNEELPPGTVIGTPVCYGLGIHAPHPQMPGAWTEEDATGANGGNGGN 13E755923B10822D nfyb9_arath Nuclear transcription factor Y subunit B-9 NFYB9 LEC1 Protein LEAFY COTYLEDON 1 T26F17.20 At1g21970 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERGAPFSHYQLPKSISELNLDQHSNNPTPMTSSVVVAGAGDKNNGIVVQQQPPCVAREQDQYMPIANVIRIMRKTLPSHAKISDDAKETIQECVSEYISFVTGEANERCQREQRKTITAEDILWAMSKLGFDNYVDPLTVFINRYREIETDRGSALRGEPPSLRQTYGGNGIGFHGPSHGLPPPGPYGYGMLDQSMVMGGGRYYQNGSSGQDESSVGGGSSSSINGMPAFDHYGQYK 7B5444BB1DD0A7EA nfyc9_arath Nuclear transcription factor Y subunit C-9 NFYC9 HAP5C Transcriptional activator HAP5C F7G19.16 At1g08970 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQQDHGQSGAMNYGTNPYQTNPMSTTAATVAGGAAQPGQLAFHQIHQQQQQQQLAQQLQAFWENQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGSIPRGTVPEAAAAGYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQPDQEN 997477FDB1E2C1AF nfyc4_arath Nuclear transcription factor Y subunit C-4 NFYC4 MLE2.10 At5g63470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNNNNNNNQQPPPTSVYPPGSAVTTVIPPPPSGSASIVTGGGATYHHLLQQQQQQLQMFWTYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREEIKEEEDAASALGGGGMVAPAASGVPYYYPPMGQPAVPGGMMIGRPAMDPSGVYAQPPSQAWQSVWQNSAGGGDDVSYGSGGSSGHGNLDSQG CA8C247594A3509C nfyb1_arath Nuclear transcription factor Y subunit B-1 NFYB1 HAP3A Transcriptional activator HAP3A T7F6.5 At2g38880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTPSSPAGDGGESGGSVREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYRELEGDNKGSGKSGDGSNRDAGGGVSGEEMPSW D33060B5AD21D9E0 nfyc6_arath Nuclear transcription factor Y subunit C-6 NFYC6 MBA10.3 At5g50480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAENNNNNGDNMNNDNHQQPPSYSQLPPMASSNPQLRNYWIEQMETVSDFKNRQLPLARIKKIMKADPDVHMVSAEAPIIFAKACEMFIVDLTMRSWLKAEENKRHTLQKSDISNAVASSFTYDFLLDVVPKDESIATADPGFVAMPHPDGGGVPQYYYPPGVVMGTPMVGSGMYAPSQAWPAAAGDGEDDAEDNGGNGGGN BEBA6928C86E3897 nfyc1_arath Nuclear transcription factor Y subunit C-1 NFYC1 HAP5A Transcriptional activator HAP5A T8P19.100 At3g48590 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTNNQQPPPSAAGIPPPPPGTTISAAGGGASYHHLLQQQQQQLQLFWTYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDEAAVLGGGMVVAPTASGVPYYYPPMGQPAGPGGMMIGRPAMDPNGVYVQPPSQAWQSVWQTSTGTGDDVSYGSGGSSGQGNLDGQG 65B0DD2F8FA14A44 cons_arath Zinc finger protein CONSTANS CO F14F8_220 At5g15840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLKQESNDIGSGENNRARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPISGNSFSSMTTTHHQSEKTMTDPEKRLVVDQEEGEEGDKDAKEVASWLFPNSDKNNNNQNNGLLFSDEYLNLVDYNSSMDYKFTGEYSQHQQNCSVPQTSYGGDRVVPLKLEESRGHQCHNQQNFQFNIKYGSSGTHYNDNGSINHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQLSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKREIEAEEQGFNTMLMYNTGYGIVPSF 56C84CF9CD45E4A6 nfyc7_arath Nuclear transcription factor Y subunit C-7 NFYC7 MBA10.2 At5g50470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEENNGNNNHYLPQPSSSQLPPPPLYYQSMPLPSYSLPLPYSPQMRNYWIAQMGNATDVKHHAFPLTRIKKIMKSNPEVNMVTAEAPVLISKACEMLILDLTMRSWLHTVEGGRQTLKRSDTLTRSDISAATTRSFKFTFLGDVVPRDPSVVTDDPVLHPDGEVLPPGTVIGYPVFDCNGVYASPPQMQEWPAVPGDGEEAAGEIGGSSGGN 4D2F9E4E51DB111E nfyb6_arath Nuclear transcription factor Y subunit B-6 NFYB6 L1L MNJ7.26 At5g47670 Protein LEAFY COTYLEDON 1-LIKE protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERGGFHGYRKLSVNNTTPSPPGLAANFLMAEGSMRPPEFNQPNKTSNGGEEECTVREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGERGVSCSAGSVSMTNGLVVKRPNGTMTEYGAYGPVPGIHMAQYHYRHQNGFVFSGNEPNSKMSGSSSGASGARVEVFPTQQHKY EC100E830E5CBB31 nfyba_arath Nuclear transcription factor Y subunit B-10 NFYB10 F4P12_40 At3g53340 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESQTGGGGGGSHESGGDQSPRSLNVREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLMRYREMEGDTKGSGKGGESSAKRDGQPSQVSQFSQVPQQGSFSQGPYGNSQGSNMMVQMPGTE 7F26A068342ED485 nfyb5_arath Nuclear transcription factor Y subunit B-5 NFYB5 F17A22.20 At2g47810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGNYHSFQNPIPRYQNYNFGSSSSNHQHEHDGLVVVVEDQQQEESMMVKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEKPNHHGKGGPKSSPDN 6465C024702AC0F9 nfyc3_arath Nuclear transcription factor Y subunit C-3 NFYC3 F14C21.41 T22H22.22 At1g54830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQQGQSSAMNYGSNPYQTNAMTTTPTGSDHPAYHQIHQQQQQQLTQQLQSFWETQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGGVGAEAATAAGYPYGYLPPGTAPIGNPGMVMGNPGAYPPNPYMGQPMWQQPGPEQQDPDN C0623D936B3C20A7 nfyc2_arath Nuclear transcription factor Y subunit C-2 NFYC2 HAP5B Transcriptional activator HAP5B F14G9.21 T6H22.3 At1g56170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQSEEGQQQQQQGVMDYVPPHAYQSGPVNAASHMAFQQAHHFHHHHQQQQQQQLQMFWANQMQEIEHTTDFKNHTLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRAWIHTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELKEEGLGVTKGTIPSVVGSPPYYYLQQQGMMQHWPQEQHPDES 38A0E251F5555DA2 co-nfyc1 2 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association o better understand the biochemical function of CO, a yeast two-hybrid library was screened to identify proteins that interact with the CCT domain (see Methods). Five clones that expressed At HAP5 homologs (At3g48590 [twice], At1g54830 [twice], and At1g56170) and one clone that expressed At HAP3a (At2g38880) were identified. In yeast, HAP2, HAP3, and HAP5 form a complex that interacts with DNA via the HAP2 subunit (Sinha et al., 1995). The observation that CO interacts with At HAP3 and At HAP5 suggested that CO might act as a novel HAP2 subunit and replace At HAP2 in a modified HAP complex. co-nfyc3 2 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 19 unspecified role unspecified role prey prey physical association physical association o better understand the biochemical function of CO, a yeast two-hybrid library was screened to identify proteins that interact with the CCT domain (see Methods). Five clones that expressed At HAP5 homologs (At3g48590 [twice], At1g54830 [twice], and At1g56170) and one clone that expressed At HAP3a (At2g38880) were identified. In yeast, HAP2, HAP3, and HAP5 form a complex that interacts with DNA via the HAP2 subunit (Sinha et al., 1995). The observation that CO interacts with At HAP3 and At HAP5 suggested that CO might act as a novel HAP2 subunit and replace At HAP2 in a modified HAP complex. co-nfyc2 2 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role prey prey physical association physical association o better understand the biochemical function of CO, a yeast two-hybrid library was screened to identify proteins that interact with the CCT domain (see Methods). Five clones that expressed At HAP5 homologs (At3g48590 [twice], At1g54830 [twice], and At1g56170) and one clone that expressed At HAP3a (At2g38880) were identified. In yeast, HAP2, HAP3, and HAP5 form a complex that interacts with DNA via the HAP2 subunit (Sinha et al., 1995). The observation that CO interacts with At HAP3 and At HAP5 suggested that CO might act as a novel HAP2 subunit and replace At HAP2 in a modified HAP complex. co-nfyb1 2 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association o better understand the biochemical function of CO, a yeast two-hybrid library was screened to identify proteins that interact with the CCT domain (see Methods). Five clones that expressed At HAP5 homologs (At3g48590 [twice], At1g54830 [twice], and At1g56170) and one clone that expressed At HAP3a (At2g38880) were identified. In yeast, HAP2, HAP3, and HAP5 form a complex that interacts with DNA via the HAP2 subunit (Sinha et al., 1995). The observation that CO interacts with At HAP3 and At HAP5 suggested that CO might act as a novel HAP2 subunit and replace At HAP2 in a modified HAP complex. co-hap5a 1 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-hap5a-1 1 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-lec1 1 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 Interactions of HAP Proteins with the CCT Domains of CO and COL15 Detected Using the Yeast Two-Hybrid System co-hap5c 1 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-hap5c 1 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-at1g54830 1 19 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-hap5b 1 20 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-hap5b 1 20 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-hap3b 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-hap3b 1 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Table 1 co-at5g50470 1 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey physical association physical association Table 1 col15-at5g50470 1 15 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-at5g50480 1 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-at5g50480 1 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-hap3a-1 4 14 unspecified role unspecified role bait bait region GAD tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 1 At HAP3a, or At HAP5a and precipitated using a GAD-specific antibody (Figures 1A to 1C). At HAP3a (Figure 1B) and At HAP5a (Figure 1C) were coimmunoprecipitated with GAD:CO, indicating that they interact with GAD:CO in this assay. co-hap5a-2 4 14 unspecified role unspecified role bait bait region GAD tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 1 co-hap5a-1 3 14 unspecified role unspecified role neutral component neutral component n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component n terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 3A These studies demonstrated nuclear colocalization for CO and HAP3a/HAP5a. co-nfyb5 1 18 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-nfyb5 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey physical association physical association Table 1 co-lec1 1 8 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-nfyb6 1 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role prey prey physical association physical association Table 1 col15-nfyb10 1 17 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-nfyb1 1 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 co-nfyb1-1 1 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association Table 1 co-nfyc5 1 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 1 col15-nfyb5-1 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Table 1 col15-nfyc4 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association Table 1 co-hap3a-2 4 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 14 unspecified role unspecified role bait bait region GAD tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Figure 1 At HAP3a, or At HAP5a and precipitated using a GAD-specific antibody (Figures 1A to 1C). At HAP3a (Figure 1B) and At HAP5a (Figure 1C) were coimmunoprecipitated with GAD:CO, indicating that they interact with GAD:CO in this assay. co-hap3a-3 3 14 unspecified role unspecified role neutral component neutral component n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component n terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Figure 3A These studies demonstrated nuclear colocalization for CO and HAP3a/HAP5a. co-hap3a-4 5 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 3B, 3C FRET was detected between YFP:CO and each of the CFP-labeled At HAP subunits (Figures 3B and 3CFigure 3.), indicating that CO is likely to interact with At HAP3a/At HAP5a in planta co-hap5a-3 5 14 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role fluorescence donor fluorescence donor n terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Figure 3B, 3C FRET was detected between YFP:CO and each of the CFP-labeled At HAP subunits (Figures 3B and 3CFigure 3.), indicating that CO is likely to interact with At HAP3a/At HAP5a in planta