IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AKRP and EMB506 are two ankyrin repeat proteins essential for plastid differentiation and plant development in Arabidopsis. AKRP and EMB506 are two ankyrin repeat proteins essential for plastid differentiation and plant development in Arabidopsis. Plant J. (0960-7412) 2006 imex curation Garcion C., Guilleminot J., Kroj T., Parcy F., Giraudat J., Devic M. devic@univ-perp.fr 03-Feb-2009: Contacted by JYOTI. Arabidopsis cDNA library from immature siliques jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Garcion C., Guilleminot J., Kroj T., Parcy F., Giraudat J., Devic M. devic@univ-perp.fr Accepted 2008-DEC-27 by JYOTI. 03-Mar-2009: Contacted by JYOTI. Arabidopsis cDNA library from immature siliques Plant J. (0960-7412) 2006 jyoti Only protein-protein interactions imex curation AKRP and EMB506 are two ankyrin repeat proteins essential for plastid differentiation and plant development in Arabidopsis. AKRP and EMB506 are two ankyrin repeat proteins essential for plastid differentiation and plant development in Arabidopsis. Plant J. (0960-7412) 2006 imex curation Garcion C., Guilleminot J., Kroj T., Parcy F., Giraudat J., Devic M. devic@univ-perp.fr 03-Feb-2009: Contacted by JYOTI. Arabidopsis cDNA library from immature siliques jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Garcion C., Guilleminot J., Kroj T., Parcy F., Giraudat J., Devic M. devic@univ-perp.fr Accepted 2008-DEC-27 by JYOTI. 03-Feb-2009: Contacted by JYOTI. Arabidopsis cDNA library from immature siliques Plant J. (0960-7412) 2006 jyoti Only protein-protein interactions imex curation em506_arath Ankyrin repeat domain-containing protein EMB506, chloroplastic EMB506 Protein EMBRYO DEFECTIVE 506 MSN9.60 At5g40160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVSSVLSIPPQTCLLPRLPISDSVNCKSKIVYCLSTSVRGSSVKRQSTARTRSFTETNRRTPSVQSKHEFWEDPDDGSDSENEYEGEEEDGIGNDLDNESDWEDDSRVQKLTTTDNYEEELAKEVEQLLEPEERVILQQNEKPNLKMISTKSWKPLQTLALSMQIQLMDNLIENGLDIDDVDKDNQTALHKAIIGKKEAVISHLLRKGANPHLQDRDGAAPIHYAVQVGALQTVKLLFKYNVDVNVADNEGWTPLHIAVQSRNRDITKILLTNGADKTRRTKDGKLALDLALCFGRDFKSYDLVKLLKIMPTGDI B13F9C8D1850E714 akrp_arath Ankyrin repeat domain-containing protein, chloroplastic AKRP AKR EMB2036 Protein EMBRYO DEFECTIVE 2036 K2A18.13 At5g66055 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQSLSTPHTISLLLPRTSPSRLSPSLHSLAFPTRLRSLSYSSQTSILPDAGDDFIVGDCLVYEDGVFEDPYLDKEVTQVAKQERKKNRRGGAKRLDESEIEPENLVPEEWRDIQAEVNLTKKDKRKIAQEMEFGVRVEKKRQGLIPLRKVDLNDFLTYKEAKLAQLRPVILDKPGNFSDDSGASSDGETAVSSPSERVAPKNPRWAVYGKGFDHVAKFFNSDKYDPSDKKSDGPRKLLSKEEKFMLNSRNPDLAVATSKKWLPLHTLAACGEFYLVDSLLKHNLDINATDVGGLTVLHRAIIGKKQAITNYLLRESANPFVLDDEGATLMHYAVQTASAPTIKLLLLYNADINAQDRDGWTPLHVAVQARRSDIVKLLLIKGADIEVKNKDGLTPLGLCLYLGREIRTYEVMKLLKEFPLSRHKKRLVTTDEDIE DE306D487CC894EC emb506-akrp 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association we used the yeast two-hybrid screen to search for proteins interacting with EMB506. The EMB506 protein lacking the chloroplast targeting signal peptide was fused to the Gal4 activation domain to serve as bait. Nineteen cDNA clones were identified among a cDNA library constructed with RNA from immature siliques (Kroj et al., 2003). These positive clones corresponded to transcription products of the same gene. blast searches in databases identified the gene as At5g66055, which codes for AKRP (ankyrin repeat protein) emb506-akrp-1 2 3 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Series of truncations of each protein were performed to define the interacting domains of AKRP and EMB506. The results presented in Figure 1 demonstrate that the two proteins bind through their ANK domains, and that binding is independent of the type of Gal4 domains used for the fusion. Figure 1 akrp-emb506 2 3 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Series of truncations of each protein were performed to define the interacting domains of AKRP and EMB506. The results presented in Figure 1 demonstrate that the two proteins bind through their ANK domains, and that binding is independent of the type of Gal4 domains used for the fusion. Figure 1