UniProt UniProt http://www.uniprot.org The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. Nat. Cell Biol. (1465-7392) 2005 Schirenbeck A., Bretschneider T., Arasada R., Schleicher M., Faix J. faix@bpc.mh-hannover.de 16-Oct-2008: Contacted by JYOTI. jyoti in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Schirenbeck A., Bretschneider T., Arasada R., Schleicher M., Faix J. faix@bpc.mh-hannover.de Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2005 jyoti The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. Nat. Cell Biol. (1465-7392) 2005 Schirenbeck A., Bretschneider T., Arasada R., Schleicher M., Faix J. faix@bpc.mh-hannover.de 16-Oct-2008: Contacted by JYOTI. jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schirenbeck A., Bretschneider T., Arasada R., Schleicher M., Faix J. faix@bpc.mh-hannover.de Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2005 jyoti The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. The Diaphanous-related formin dDia2 is required for the formation and maintenance of filopodia. Nat. Cell Biol. (1465-7392) 2005 Schirenbeck A., Bretschneider T., Arasada R., Schleicher M., Faix J. faix@bpc.mh-hannover.de 16-Oct-2008: Contacted by JYOTI. jyoti dicdi Dictyostelium discoideum (Slime mold) Slime mold anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Schirenbeck A., Bretschneider T., Arasada R., Schleicher M., Faix J. faix@bpc.mh-hannover.de Accepted 2008-OCT-22 by JYOTI. 16-Oct-2008: Contacted by JYOTI. Nat. Cell Biol. (1465-7392) 2005 jyoti prof2_dicdi Profilin-2 proB Profilin II DDB_G0286187 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTWQAYVDNNLLGAGFASAALLGAADGSVWAHSAGFNVAEGKAITALFQKDGAAFATGIHVAGKKYMAIKSDTRSAYGKLGAGGVVCVKTLTCIIVAVYDDKLQPGAAANIAEKLADYLIDNNC 04F5617BF0DB5A8F rac1a_dicdi Rho-related protein rac1A rac1A DDB_G0277869 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSIISPSSFENVNGKWHPEICHHAPNVPIILVGTKLDMREDKETQDRLKEKKLYPISYEQGLAKMKEINAVKYLECSALTQKGLKTVFDEAIRAVINPPLSKKKKSSGGCNIL 718E2BDE338E0005 rgaa_dicdi Ras GTPase-activating-like protein rgaA rgaA DDB_G0287585 DG1029 rasGAP1 Developmental gene 1029 protein protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MNKEEYSDISDSESEEVHETNNHNEHEHEEEDDTPEIVVPERKFLKEDEDYSVPFPVMRECLVLLLQSRRILRDMMYYRFKMDRFLSGNLSVFEIQNLLHSQREDKESDWIAEIQELKRNLVSEVRRNHTLERDLNRLDKRIALLIKNRGNIQDVLADKAGLKAPKHKGDQKKPELINDPKKLEAYQNLFYLLQTEPKYLAGLVYLIQPEQMESFLGTVILTLFGDAFTPREEFLLLSLYRLSIQKEMANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYAAIISEQEIRTGEKSTLDRNVSHEKALEVPEVTKTIKARVDQLISICEQFLDGIISSLNRLPYGIRWICKQIYQIAEKNFTKSTQDEILKVIGYFIYYRFIQVAMVSPEEYDLVGREIHPTARKNLINVSKVLQALFNFAQFGSSEKHFIPLNGWITSHMGDIKNYLQEIIEVGEPEDYLQVDKYMELTQKTKPVIIISLPEICNTHQLISKNLDSLVAKGEKDDPMRIIMKELDEFGPPPDIAADDDREVQLTLSNKFQKTIEEELSPGESLLSQTKEMVISLLRALPTLPEQKDQSDEPPNLVDVLNKARQADPSLEPEIKKILDNLKKLEEYNLTTSADNYSSFLKAVALEVVNRAEIREQQKKEKQRLTTSLNNLRKHQKYLNEQIAQYNQYLQDCRLKHYQNKSKKKKKGDGAKVGPFKFSFSELHKKGVIVDSEVPQITRKKIKFVISSDTVGVFDVSAKMAGIDVQTMRLELDDLLELNSIGTTTLELDQITLDVNMTIHLLNKLFLY D892AE507715C67A forh_dicdi Formin-H forH dia2 drf2 DDB_G0285589 Diaphanous-related formin dia2 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSFDLESNSSGGSTIGRNSSIRLSSGLAPSESTVSLNEIIDLDREFELLLDKLAIEDPIKRKQMQSLPDISKRTLLEQNKADIYRTVKHKGPIESFADVKSVISSINTKHVPIDIIKTLRIHLNTADRDWIQSFLDNDGVQPILNILKRLERNKNRKRKEHSILQWECTRCIAALMKIKIGMEYIASFPQTTNLMVLCLDTPLIKAKTLVLELLAAIAVTDRGHGAVLTSMIYHKEVKKEITRYFNLVQSLKIEKNAEYLTTCMSFINCIISSPSDLPSRIEIRKAFLNLKILKYIENLRADYNEDKNLLTQLDVFEEELSTDEQLNSQQGTQIGIEDLFSQISSRVTGTPSQQELITLMTHFQRMSSSNLGLGVWTLYNALANQLEDELKIHPDLDVTLVSLLFPEVKKSSSGLFGFGSKSKSPSSSPALSSMAKTELKKDNEEKQKTIEHLLKQLNKFSGGQNTERWMIEREEKNKLIAQLMAQTKNGGGGGGGGVGGDSSLSNDEALKRENQLLRMEIENIKNNPSVLLNSGNSINGDVPNLFISSPGSTLSPSPSGEPPIPSTDFGITSSSIHTSTDKLTNSTEPILGSPPPPPPPPMSGGGGPPPPPPPPGGKSNKPAKPIIKPSVKMRNFNWITIPALKVQGTFWDKLDETSFIQSLDKVELESLFSAKAPTVKVESKQLTRKVVVTVIDMKKANNCAIMLQHFKIPNEQLKKMQIMLDEKHFSQENAIYLLQFAPTKEDIEAIKEYQGDQMQLGAAEQYMLTVMDIPKLDSRLKAFIFKQKFEGLVEDLVPDIKAIKAASLELKKSKRLSDILKFILAIGNYVNGSTTRGGAFGFKVLETLPKMRDARSNDNKLSLLHFLAKTLQDRIPEIWNIGAELPHIEHASEVSLNNIISDSSEIKRSIDLIERDFVPMINDPLFAHDKHWIHKITEFQKIAKVQYQRIEKEIDEMNKAFEEITSYFGEPKSTQPDVFFSTINNFLEDLEKAYGEYQAMIRKAELENSKMEDPEKGGLQDLSSQIRSGQLFKDRRVGDSVIAQMQNVDSLRKNLKSTSTTTPNTPPTIKIELPSQSILKPSGQLKK DIP protein Q54N00 original sequence version: 62 F92BADEE145E0BD9 prob-forh-1 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1c rac1a-forh-1 1 5 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range dicdi Dictyostelium discoideum (Slime mold) Slime mold physical association physical association Fig 1d Interaction between rac1A and forH is stimulated by GTP-gamma-S. rac1a-rgaa-1 1 6 unspecified role unspecified role prey prey dicdi Dictyostelium discoideum (Slime mold) Slime mold 5 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 1d Interaction between rac1A and rgaA is stimulated by GTP-gamma-S. forh-rac1a-1 3 5 unspecified role unspecified role prey prey n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P34144:p.Thr17Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T N Wed May 02 15:39:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 18:22:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' P34144:p.Gly12Val mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G V Wed May 02 17:16:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 15:59:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait dicdi Dictyostelium discoideum (Slime mold) Slime mold physical association physical association Fig 1e