MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The BPV-1 E5 protein, the 16 kDa membrane pore-forming protein and the PDGF receptor exist in a complex that is dependent on hydrophobic transmembrane interactions. The BPV-1 E5 protein, the 16 kDa membrane pore-forming protein and the PDGF receptor exist in a complex that is dependent on hydrophobic transmembrane interactions. EMBO J. (0261-4189) 1992 rapid curation Goldstein DJ., Andresson T., Sparkowski JJ., Schlegel R. Virus - Publications including interactions involving viral proteins suggested by aceol rapid curation chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Goldstein DJ., Andresson T., Sparkowski JJ., Schlegel R. Virus - Publications including interactions involving viral proteins suggested by aceol EMBO J. (0261-4189) 1992 rapid curation rapid curation vatl_human V-type proton ATPase 16 kDa proteolipid subunit ATP6V0C ATP6C ATP6L ATPL Vacuolar proton pump 16 kDa proteolipid subunit protein protein human Homo sapiens Human MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 91141854A0492A5B ve5_bpv1 Protein E5 E5 protein protein bpv1 Bovine papillomavirus type 1 MPNLWFLLFLGLVAAMQLLLLLFLLLFFLVYWDHFECSCTGLPF This sequence has been withdrawn from Uniprot. 0E278099E06F2956 mint E5 can induce cellular DNA synthesis. It seems to interact with a 16 kDa cellular protein. E5 seems to activate the PDGF receptor 0E278099E06F2956 vatl_bovin V-type proton ATPase 16 kDa proteolipid subunit ATP6V0C ATP6C ATP6L Vacuolar proton pump 16 kDa proteolipid subunit protein protein bovin Bos taurus (Bovine) Bovine MSEAKNGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells mint 326B20B5F7D7D607 pgfrb_human Platelet-derived growth factor receptor beta CD140 antigen-like family member B PDGFRB Beta-type platelet-derived growth factor receptor PDGFR Platelet-derived growth factor receptor 1 Beta platelet-derived growth factor receptor PDGFR1 protein protein human Homo sapiens Human MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFSGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDHQDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDSSAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVLELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNVTYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNALPVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVPSAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDNDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQVEPEPELEQLPDSGCPAPRAEAEDSFL DIP protein P09619 original sequence version: 176 DIP protein P09619 original sequence version: 185 DIP protein P09619 original sequence version: 114 DIP protein P09619 original sequence version: 162 DIP protein P09619 original sequence version: 150 DIP protein P09619 original sequence version: 165 DIP protein P09619 original sequence version: 161 038C15E531D6E89D e5-pdgfrb 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:47:51 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation decreasing' range MINT-6628520: original sequence: 17-17 : LLFLGLVAAMQLLLLLFLLL 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F1 homomint mint atp6v0c-e5 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate 2 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F1 for p16 vacuolar ATPase it was used the human protein identifier homomint mint atp6v0c-pdgfrb 1 2 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F3 for p16 vacuolar ATPase it was used the human protein identifier homomint mint atp6v0c-e5-1 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate 2 unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5 for p16 vacuolar ATPase it was used the human protein identifier homomint mint atp6v0c-pdgfrb-1 1 4 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F3 homomint mint e5-pdgfrb-1 1 3 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate 5 unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F5 f5 homomint mint