IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Yeast two-hybrid studies on interaction of proteins involved in regulation of nitrogen fixation in the phototrophic bacterium Rhodobacter capsulatus. Yeast two-hybrid studies on interaction of proteins involved in regulation of nitrogen fixation in the phototrophic bacterium Rhodobacter capsulatus. J. Bacteriol. (0021-9193) 2003 imex curation Pawlowski A., Riedel KU., Klipp W., Dreiskemper P., Gross S., Bierhoff H., Drepper T., Masepohl B. bernd.masepohl@ruhr-uni-bochum.de 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pawlowski A., Riedel KU., Klipp W., Dreiskemper P., Gross S., Bierhoff H., Drepper T., Masepohl B. bernd.masepohl@ruhr-uni-bochum.de Accepted 2008-NOV-21 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. R. capsulatus genomic library J. Bacteriol. (0021-9193) 2003 orchard Only protein-protein interactions imex curation Yeast two-hybrid studies on interaction of proteins involved in regulation of nitrogen fixation in the phototrophic bacterium Rhodobacter capsulatus. Yeast two-hybrid studies on interaction of proteins involved in regulation of nitrogen fixation in the phototrophic bacterium Rhodobacter capsulatus. J. Bacteriol. (0021-9193) 2003 imex curation Pawlowski A., Riedel KU., Klipp W., Dreiskemper P., Gross S., Bierhoff H., Drepper T., Masepohl B. bernd.masepohl@ruhr-uni-bochum.de 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pawlowski A., Riedel KU., Klipp W., Dreiskemper P., Gross S., Bierhoff H., Drepper T., Masepohl B. bernd.masepohl@ruhr-uni-bochum.de Accepted 2008-NOV-21 by ORCHARD. J. Bacteriol. (0021-9193) 2003 orchard Only protein-protein interactions imex curation glnk_rhoca_protein protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata An amino acid sequence which is not represented in UniProt q2mhs1_rhoca nifA2 protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata MRFTRSRRPLRRCPDP 11876BF67E469EF2 ntrb_rhocb Sensory histidine kinase/phosphatase NtrB RCAP_rcc01797 ntrB nifR2 Nitrogen regulation protein NR(II) Nitrogen regulator II protein protein rhocb Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) MNLPPPGIIWNSLPLPALMLDVNDRVIEINPAAELFLNLSARALKGQALGERLAISAPLEEIFARVRKNRSALFVNDVDLTTGERAPVQCNLQAAPIADDPETVLLLISPREIADRLGRASMVKSAARSAIGMAEMLAHEIKNPLAGIAGAAQLLSMGLSGEDLELTDLIVDETRRIVKLLEQVEQFGNVRPPEMKPVNIHDVLDRARKSAGVGFGAHMLIVEDYDPSLPPTLGDADQLTQVFLNLLKNASEAAKGQGTIRLRTFYDYALRLRRPDGGGQRLPLQVEVIDDGPGIPADIASSIFEPFVSGRENGTGLGLALVSKIISEHNGWISVESAPGRTLFRISLPVAPKEL B3EE3FED0B6C645F era_rhoca_protein protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata An amino acid sequence which is not represented in UniProt Similar to Q3J5W0 pcra_rhoca_protein protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata An amino acid sequence which is not represented in UniProt Similar to Q0S536 q52690_rhoca draT protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata MDQTFSPSARLGHSTNLVGAPSAWMASPGFNDRPVALHIWGVREMNPALFTMLDQAETLAEAGEPFWPIWCDVRHRPRAARRRPGQRKRFRSSFLRLIQGWGFDSNGPEGAVLKGWVESRFGILPSFHKEIIPDTQGPVWQAYVAERMQSRFHDNAILVQLDLLFEFCQWAVAVSPIRGKASDALSRHQCGRPAWHSGTAKPPRVIRLNNLVSFSSDREVADCFGDRIITTRVPLAKVLFFPGLLPSPLLRGEREFLVLGGAFRVSIEDI 352658C9AFCFB1CE glnb_rhoca Nitrogen regulatory protein P-II glnB protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata MKKVEAIIKPFKLDEVKEALQEAGIQGLSVIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEMVLPDEMVDIAIEAIVGAARTEKIGDGKIFVSSIEQAIRIRTGETGEDAV 6E4CA130963B6426 glnb-ntrb 2 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1 GlnB-NtrB interaction in a yeast two-hybrid assay glnb-ntrb-3 1 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 Screening of an R. capsulatus genomic library identified NtrB, NifA2, DraT, and PcrA as proteins that interact with GlnB and Era as a protein that interacts with GlnK. glnb-nifa2 1 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 2 Screening of an R. capsulatus genomic library identified NtrB, NifA2, DraT, and PcrA as proteins that interact with GlnB and Era as a protein that interacts with GlnK. glnb-drat 1 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 2 Screening of an R. capsulatus genomic library identified NtrB, NifA2, DraT, and PcrA as proteins that interact with GlnB and Era as a protein that interacts with GlnK. glnb-pcra 1 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 2 Screening of an R. capsulatus genomic library identified NtrB, NifA2, DraT, and PcrA as proteins that interact with GlnB and Era as a protein that interacts with GlnK. glnk-era 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 2 Screening of an R. capsulatus genomic library identified NtrB, NifA2, DraT, and PcrA as proteins that interact with GlnB and Era as a protein that interacts with GlnK.