IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and analysis of Escherichia coli proteins that interact with the histidine kinase NtrB in a yeast two-hybrid system. Identification and analysis of Escherichia coli proteins that interact with the histidine kinase NtrB in a yeast two-hybrid system. Mol. Genet. Genomics (1617-4615) 2003 imex curation Salinas P., Contreras A. E. coli libraries S0, S1 and S2 were pooled in a 1:1:1 ratio and transformed into S. cerevisiae containing the bait plasmid. contrera@ua.es 03-Feb-2009: Contacted by JYOTI. E coli libraries S0, S1 and S2 davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Salinas P., Contreras A. E. coli libraries S0, S1 and S2 were pooled in a 1:1:1 ratio and transformed into S. cerevisiae containing the bait plasmid. contrera@ua.es Accepted 2009-FEB-8 by DAVET. 03-Mar-2009: Contacted by JYOTI. E coli libraries S0, S1 and S2 Mol. Genet. Genomics (1617-4615) 2003 davet Only protein-protein interactions imex curation Identification and analysis of Escherichia coli proteins that interact with the histidine kinase NtrB in a yeast two-hybrid system. Identification and analysis of Escherichia coli proteins that interact with the histidine kinase NtrB in a yeast two-hybrid system. Mol. Genet. Genomics (1617-4615) 2003 imex curation Salinas P., Contreras A. E. coli libraries S0, S1 and S2 were pooled in a 1:1:1 ratio and transformed into S. cerevisiae containing the bait plasmid. contrera@ua.es 03-Feb-2009: Contacted by JYOTI. E coli libraries S0, S1 and S2 davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Salinas P., Contreras A. E. coli libraries S0, S1 and S2 were pooled in a 1:1:1 ratio and transformed into S. cerevisiae containing the bait plasmid. contrera@ua.es Accepted 2009-FEB-8 by DAVET. 03-Feb-2009: Contacted by JYOTI. E coli libraries S0, S1 and S2 Mol. Genet. Genomics (1617-4615) 2003 davet Only protein-protein interactions imex curation ntrb_ecoli Sensory histidine kinase/phosphatase NtrB glnL glnR ntrB b3869 JW3840 Nitrogen regulation protein NR(II) Nitrogen regulator II protein protein ecoli Escherichia coli (strain K12) MATGTQPDAGQILNSLINSILLIDDNLAIHYANPAAQQLLAQSSRKLFGTPLPELLSYFSLNIELMQESLEAGQGFTDNEVTLVIDGRSHILSVTAQRMPDGMILLEMAPMDNQRRLSQEQLQHAQQVAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLLEYTKVIIEQADRLRNLVDRLLGPQLPGTRVTESIHKVAERVVTLVSMELPDNVRLIRDYDPSLPELAHDPDQIEQVLLNIVRNALQALGPEGGEIILRTRTAFQLTLHGERYRLAARIDVEDNGPGIPPHLQDTLFYPMVSGREGGTGLGLSIARNLIDQHSGKIEFTSWPGHTEFSVYLPIRK 8B6B3BB18B2E2E98 glnb_ecoli Nitrogen regulatory protein P-II 1 glnB b2553 JW2537 protein protein ecoli Escherichia coli (strain K12) MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFGRQKGHTELYRGAEYMVDFLPKVKIEIVVPDDIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDDAAI D1A4158A2F225042 glnk_ecoli Nitrogen regulatory protein GlnK ybaI glnK b0450 JW0440 Nitrogen regulatory protein P-II 2 PII-like protein protein protein ecoli Escherichia coli (strain K12) MKLVTVIIKPFKLEDVREALSSIGIQGLTVTEVKGFGRQKGHAELYRGAEYSVNFLPKVKIDVAIADDQLDEVIDIVSKAAYTGKIGDGKIFVAELQRVIRIRTGEADEAAL DIP protein P0AC55 original sequence version: 79 1875CD92C162B537 ntrc_ecoli DNA-binding transcriptional regulator NtrC glnG glnT ntrC b3868 JW3839 Nitrogen regulation protein NR(I) Nitrogen regulator I protein protein ecoli Escherichia coli (strain K12) MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGMDGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQEQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHALHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLFHRLNVIRVHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVRQLENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQMQPDSWATLLAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME 645F401D4A10EFA0 aspa_ecoli Aspartate ammonia-lyase aspA b4139 JW4099 protein protein ecoli Escherichia coli (strain K12) MSNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDIPEFVRGMVMVKKAAAMANKELQTIPKSVANAIIAACDEVLNNGKCMDQFPVDVYQGGAGTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIKLVDAINQLREGFERKAVEFQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAELLLEVNLGATAIGTGLNTPKEYSPLAVKKLAEVTGFPCVPAEDLIEATSDCGAYVMVHGALKRLAVKMSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVCFKVIGNDTTVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLEKCINGITANKEVCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFSVQNLMHPAYKAKRYTDESEQ B6E8432DBF385DEA B6E8432DBF385DEA ntrb-ntrc 1 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 1 ntrb-ntrc-1 1 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 1 ntrc-ntrc 1 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1 ntrb-glnb 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 1 ntrb-glnb-1 1 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 1 ntrb-ntrb-3 1 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 1 homodimerisation shown glnk-ntrb-3 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 3A,B glnk/ntrbhng - type1 constructs containing only N and NG regions are not sufficient to generate Y2H signals with GlnK, suggesting that part of the H domain is also required for contacts with PII proteins glnk-ntrb-4 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 3A,B ntrbhng/glnk - type2 constructs containing only N and NG regions are not sufficient to generate Y2H signals with GlnK, suggesting that part of the H domain is also required for contacts with PII proteins aspa-ntrb 2 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3A,B aspa/ntrbhng>ntrb>ntrbsh>ntrbh>ntrbhn AspA91 312/NtrB pair of fusion proteins gave strong signals in strain Y190. Similar signals were obtained for AspA91 312/NtrBHNG, while weak but significant signals were obtained when AspA91 312 was paired with NtrBSHN, NtrBSH, NtrBHN or NtrBH aspa-ntrb-1 2 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3A,B ntrbhng/aspa - type4 AspA91 312/NtrB pair of fusion proteins gave strong signals in strain Y190. Similar signals were obtained for AspA91 312/NtrBHNG, while weak but significant signals were obtained when AspA91 312 was paired with NtrBSHN, NtrBSH, NtrBHN or NtrBH