IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses. The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses. Plant Cell (1040-4651) 2003 Feng S., Ma L., Wang X., Xie D., Dinesh-Kumar SP., Wei N., Deng XW. Antibodies used to detect the presence of CSN5 and CSN6 proteins did not distinguish between specific isoforms of these proteins and results using these reagents were not curated. no Flower extracts prepared from wild-type Arabidopsis were used in this study. xingwang.deng@yale.edu 16-April-2008: Contacted by JYOTI. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Feng S., Ma L., Wang X., Xie D., Dinesh-Kumar SP., Wei N., Deng XW. Antibodies used to detect the presence of CSN5 and CSN6 proteins did not distinguish between specific isoforms of these proteins and results using these reagents were not curated. no Flower extracts prepared from wild-type Arabidopsis were used in this study. xingwang.deng@yale.edu Accepted 2008-APR-3 by JYOTI. Plant Cell (1040-4651) 2003 The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses. The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses. Plant Cell (1040-4651) 2003 Feng S., Ma L., Wang X., Xie D., Dinesh-Kumar SP., Wei N., Deng XW. Antibodies used to detect the presence of CSN5 and CSN6 proteins did not distinguish between specific isoforms of these proteins and results using these reagents were not curated. no Flower extracts prepared from wild-type Arabidopsis were used in this study. xingwang.deng@yale.edu 16-April-2008: Contacted by JYOTI. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Feng S., Ma L., Wang X., Xie D., Dinesh-Kumar SP., Wei N., Deng XW. Antibodies used to detect the presence of CSN5 and CSN6 proteins did not distinguish between specific isoforms of these proteins and results using these reagents were not curated. no Flower extracts prepared from wild-type Arabidopsis were used in this study. xingwang.deng@yale.edu Accepted 2008-APR-3 by JYOTI. 16-April-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2003 The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses. The COP9 signalosome interacts physically with SCF COI1 and modulates jasmonate responses. Plant Cell (1040-4651) 2003 Feng S., Ma L., Wang X., Xie D., Dinesh-Kumar SP., Wei N., Deng XW. Antibodies used to detect the presence of CSN5 and CSN6 proteins did not distinguish between specific isoforms of these proteins and results using these reagents were not curated. no Flower extracts prepared from wild-type Arabidopsis were used in this study. xingwang.deng@yale.edu 16-April-2008: Contacted by JYOTI. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Feng S., Ma L., Wang X., Xie D., Dinesh-Kumar SP., Wei N., Deng XW. Antibodies used to detect the presence of CSN5 and CSN6 proteins did not distinguish between specific isoforms of these proteins and results using these reagents were not curated. no Flower extracts prepared from wild-type Arabidopsis were used in this study. xingwang.deng@yale.edu Accepted 2008-APR-3 by JYOTI. 16-April-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2003 cul1_arath Cullin-1 CUL1 At4g02570 T10P11.26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERKTIDLEQGWDYMQTGITKLKRILEGLNEPAFDSEQYMMLYTTIYNMCTQKPPHDYSQQLYDKYREAFEEYINSTVLPALREKHDEFMLRELFKRWSNHKVMVRWLSRFFYYLDRYFIARRSLPPLNEVGLTCFRDLVYNELHSKVKQAVIALVDKEREGEQIDRALLKNVLDIYVEIGMGQMERYEEDFESFMLQDTSSYYSRKASSWIQEDSCPDYMLKSEECLKKERERVAHYLHSSSEPKLVEKVQHELLVVFASQLLEKEHSGCRALLRDDKVDDLSRMYRLYHKILRGLEPVANIFKQHVTAEGNALVQQAEDTATNQVANTASVQEQVLIRKVIELHDKYMVYVTECFQNHTLFHKALKEAFEIFCNKTVAGSSSAELLATFCDNILKKGGSEKLSDEAIEDTLEKVVKLLAYISDKDLFAEFYRKKLARRLLFDRSANDDHERSILTKLKQQCGGQFTSKMEGMVTDLTLARENQNSFEDYLGSNPAANPGIDLTVTVLTTGFWPSYKSFDINLPSEMIKCVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIELIVSTYQAAVLLLFNTTDKLSYTEILAQLNLSHEDLVRLLHSLSCAKYKILLKEPNTKTVSQNDAFEFNSKFTDRMRRIKIPLPPVDERKKVVEDVDKDRRYAIDAAIVRIMKSRKVLGHQQLVSECVEQLSRMFKPDIKAIKKRMEDLITRDYLERDKENPNMFRYLA DIP protein Q94AH6 original sequence version: 102 DIP protein Q94AH6 original sequence version: 95 45041357DE8DAD8C csn3_arath COP9 signalosome complex subunit 3 Protein FUSCA 11 CSN3 FUS11 At5g14250 F18O22.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MIGAVNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGLVKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM 77AD165F559BCE12 csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH D182ABACE4238759 csn4_arath COP9 signalosome complex subunit 4 Constitutive photomorphogenesis protein 8 Protein FUSCA 4 CSN4 COP8 FUS4 At5g42970 MBD2.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV 1E8AEF28C35B28F0 coi1_arath Coronatine-insensitive protein 1 FBL2 At2g39940 COI1 COI-1 F-box/LRR-repeat protein 2 T28M21.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEDPDIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCYTATPDRLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLETEDHCTLIQKCPNLEVLETRNVIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRGLIALAQGCQELEYMAVYVSDITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWMLLGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYRASMTGQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQRTDCPTTVRVLKEPI DIP protein O04197 original sequence version: 103 DIP protein O04197 original sequence version: 98 DIP protein O04197 original sequence version: 80 DIP protein O04197 original sequence version: 84 DIP protein O04197 original sequence version: 101 DIP protein O04197 original sequence version: 119 1DDCF04990144C06 cop1-cul1-cop9 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey association association Figure 2A Coimmunoprecipitation Analysis of the Physical Association of CSN and SCFCOI1 in Vivo. The authors state that CSN5 was part of the protein complex. csn4-cul1-cop9-1 1 7 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association Figure 2A Coimmunoprecipitation Analysis of the Physical Association of CSN and SCFCOI1 in Vivo. col1-cul1-cop9 2 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Figure 2B Coimmunoprecipitation Analysis of the Physical Association of CSN and SCFCOI1 in Vivo. The authors state CSN5 and CSN6 proteins were present in the immunopreciptaterd complex , however the anti-body used to detect these proteins did not distinguish between them. This data was not curated into this entry. col1-cul1 3 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association Figure 3 CSN and SCFCOI1 Form a Large Complex in Vivo, as Shown by Gel-Filtration Analyses. The authors stated CSN5 was part of the complex.