UniProt UniProt http://www.uniprot.org The GLH proteins, Caenorhabditis elegans P granule components, associate with CSN-5 and KGB-1, proteins necessary for fertility, and with ZYX-1, a predicted cytoskeletal protein. The GLH proteins, Caenorhabditis elegans P granule components, associate with CSN-5 and KGB-1, proteins necessary for fertility, and with ZYX-1, a predicted cytoskeletal protein. Dev. Biol. (0012-1606) 2002 imex curation Smith P., Leung-Chiu WM., Montgomery R., Orsborn A., Kuznicki K., Gressman-Coberly E., Mutapcic L., Bennett K. did not annotate the 2 hybrid screen described in this paper as it is not clear which of the targets identified interacted with which of the 2 baits (glh1 and glh3 were both used). The paper is not clear on this - it is explicitly mentioned nowhere. bennett@missouri.edu 01-Feb-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Smith P., Leung-Chiu WM., Montgomery R., Orsborn A., Kuznicki K., Gressman-Coberly E., Mutapcic L., Bennett K. did not annotate the 2 hybrid screen described in this paper as it is not clear which of the targets identified interacted with which of the 2 baits (glh1 and glh3 were both used). The paper is not clear on this - it is explicitly mentioned nowhere. bennett@missouri.edu Accepted 2008-FEB-21 by JYOTI. 01-Feb-2008: Contacted by JYOTI. Dev. Biol. (0012-1606) 2002 Only protein-protein interactions imex curation The GLH proteins, Caenorhabditis elegans P granule components, associate with CSN-5 and KGB-1, proteins necessary for fertility, and with ZYX-1, a predicted cytoskeletal protein. The GLH proteins, Caenorhabditis elegans P granule components, associate with CSN-5 and KGB-1, proteins necessary for fertility, and with ZYX-1, a predicted cytoskeletal protein. Dev. Biol. (0012-1606) 2002 imex curation Smith P., Leung-Chiu WM., Montgomery R., Orsborn A., Kuznicki K., Gressman-Coberly E., Mutapcic L., Bennett K. did not annotate the 2 hybrid screen described in this paper as it is not clear which of the targets identified interacted with which of the 2 baits (glh1 and glh3 were both used). The paper is not clear on this - it is explicitly mentioned nowhere. bennett@missouri.edu 01-Feb-2008: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Smith P., Leung-Chiu WM., Montgomery R., Orsborn A., Kuznicki K., Gressman-Coberly E., Mutapcic L., Bennett K. did not annotate the 2 hybrid screen described in this paper as it is not clear which of the targets identified interacted with which of the 2 baits (glh1 and glh3 were both used). The paper is not clear on this - it is explicitly mentioned nowhere. bennett@missouri.edu Accepted 2008-FEB-21 by JYOTI. 01-Feb-2008: Contacted by JYOTI. Dev. Biol. (0012-1606) 2002 Only protein-protein interactions imex curation The GLH proteins, Caenorhabditis elegans P granule components, associate with CSN-5 and KGB-1, proteins necessary for fertility, and with ZYX-1, a predicted cytoskeletal protein. The GLH proteins, Caenorhabditis elegans P granule components, associate with CSN-5 and KGB-1, proteins necessary for fertility, and with ZYX-1, a predicted cytoskeletal protein. Dev. Biol. (0012-1606) 2002 imex curation Smith P., Leung-Chiu WM., Montgomery R., Orsborn A., Kuznicki K., Gressman-Coberly E., Mutapcic L., Bennett K. did not annotate the 2 hybrid screen described in this paper as it is not clear which of the targets identified interacted with which of the 2 baits (glh1 and glh3 were both used). The paper is not clear on this - it is explicitly mentioned nowhere. bennett@missouri.edu 01-Feb-2008: Contacted by JYOTI. Only protein-protein interactions spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection pull down pull down anti tag western anti tag western blot anti tag western Smith P., Leung-Chiu WM., Montgomery R., Orsborn A., Kuznicki K., Gressman-Coberly E., Mutapcic L., Bennett K. did not annotate the 2 hybrid screen described in this paper as it is not clear which of the targets identified interacted with which of the 2 baits (glh1 and glh3 were both used). The paper is not clear on this - it is explicitly mentioned nowhere. bennett@missouri.edu Accepted 2008-FEB-21 by JYOTI. 01-Feb-2008: Contacted by JYOTI. Dev. Biol. (0012-1606) 2002 Only protein-protein interactions imex curation snf1_yeast Carbon catabolite-derepressing protein kinase SNF1 CAT1 CCR1 GLC2 PAS14 Sucrose nonfermentating protein 1 D8035.20 YDR477W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSNNNTNTAPANANSSHHHHHHHHHHHHHGHGGSNSTLNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPEYLLPPDLKPHPEEENENNDSKKDGSSPDNDEIDDNLVNILSSTMGYEKDEIYESLESSEDTPAFNEIRDAYMLIKENKSLIKDMKANKSVSDELDTFLSQSPPTFQQQSKSHQKSQVDHETAKQHARRMASAITQQRTYHQSPFMDQYKEEDSTVSILPTSLPQIHRANMLAQGSPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDLWTIKLRWKYDIGNKTNTNEKIPDLMKMVIQLFQIETNNYLVDFKFDGWESSYGDDTTVSNISEDEMSTFSAYPFLHLTTKLIMELAVNSQSN F5C63565C986C4E3 F5C63565C986C4E3 glh3_caeel ATP-dependent RNA helicase glh-3 Germline helicase 3 glh-3 B0414.6 protein protein caeel Caenorhabditis elegans MDKSPTKTSIRTKFARHQPISDVDTTEQSSSCIKKDDRGLSSFGVQSSVFSRRSCRMSELEAKPTIISEDQRIAVRSEIGGSFSGFDDKVDNVFHSNNNLHGSPSTTELECPGIMNPRFLVGRSLNSRSRAVTRGSKRTSNVKENEGSIHRSDDQVSTENCSAKDEERDRDSGGVSSYGNKRSDEFCGTSPILEAKGFGISNTCFNCKKYGHRATECSAPQRECANCGDPNHRANECASWSKNGVQEPTKVTYVPVVDKMEEVFSMLKINAGDFFDKFFDASVQLVSRGQPVTIQPCKSFSDSDIPQSMRRNVERAGYTRTTPIQQYTLPLVADGKDILACAQTGSGKTAAFLLPIMSRLILEKDLNYGAEGGCYPRCIILTPTRELADQIYNEGRKFSYQSVMEIKPVYGGINVGYNKSQIMKGCTIIVGTIGRVKHFCEDGAIKLDKCRYLVLDEADRMIDSMGFGPEIEQIINYKNMPKNDKRQTMMFSATFPSSVQEAARKLLREDYTMITIDKIGAANKCVIQEFELCDRTSKVDKLLKLLGIDIDTYTTEKNSDVFVKKTIVFVAQQKMADTLASIMSAAQVPAITIHGAREQKERSAALKLFRSGAKPVLIATAVVERGLDIKGVDHVINYDMPNNIDDYIHRIGRTGRVGNSGRATSFISLADDVQILPQLVRTLADAEQVVPSWMKEAAGGTSNPNKFEKSIDTEEPEEAW A91F49FE2B79DEAA csn5_caeel COP9 signalosome complex subunit 5 B0547.1 JAB1 homolog csn-5 protein protein caeel Caenorhabditis elegans MEVDNVKPSSSVPQRNWEKENNVQNVDSIFEYNNKQQVEIRNAKPWDKDPHYFKQIKISAIALLKMTMHAKRGGNLEIMGLLQGRIDANSFIILDVFALPVEGTETRVNAQAQAYEYMTVYSEMCDTEGRKEKVVGWYHSHPGYGCWLSGIDVSTQTLNQKFQEPWVAIVIDPLRTMSAGKVDIGAFRTYPEGYRPPDDVPSEYQSIPLAKIEDFGVHCKRYYSLDVSFFKSQLDAHILTSLWNSYWISTLSSSPLFSNVEFLNNQIQDINQKLSAVDKKLQLNDRSVDGHEALMKVVTDAKAVGDELETGRISHLVKQLLFARQAGGGCGCSHASAGSPMDIAVATEPEKAGPSPSAPEPAVEMADA 0DA27521156E0E70 aakg_yeast 5'-AMP-activated protein kinase subunit gamma SNF4 CAT3 Regulatory protein CAT3 SCI1 Sucrose non-fermenting protein 4 YGL115W protein protein yeast Saccharomyces cerevisiae Baker's yeast MKPTQDSQEKVSIEQQLAVESIRKFLNSKTSYDVLPVSYRLIVLDTSLLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYFSNPDKFELVDKLQLDGLKDIERALGVDQLDTASIHPSRPLFEACLKMLESRSGRIPLIDQDEETHREIVVSVLTQYRILKFVALNCRETHFLKIPIGDLNIITQDNMKSCQMTTPVIDVIQMLTQGRVSSVPIIDENGYLINVYEAYDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCTKNDKLSTIMDNIRKARVHRFFVVDDVGRLVGVLTLSDILKYILLGSN 51B387E346EE9561 51B387E346EE9561 zyx_caeel Zyxin zyx-1 F42G4.3 protein protein caeel Caenorhabditis elegans MGPPPPPPPPPLLPSGEILPSRKWKTEDAPRRNNHPAPAPPKPSRPTVDASALQHAAARLRKTGYNEPVRGDVENLSDGRLDRPHQQLPDGDRTYRANLQQLAQPKTRAEIPSPPTYSNQPRPLGDFHRDPNALSQFQQSREALLSSTSPTSNYSPINKFSSSTLTQYANKSPSPPSFGNSNSEATYVSPYSSKHSYPTNFRSYHKDDDYFNNTATTATTTTSSNSLNENNNSNKYGNKETVLQWSEPYDPSKIRRSQSPIRNAREMIHEYSTTNYVTEVQQPPPPPPDLYQRMTQARTFLQNSLAKQLRDEGLTESQKAANRNQTGALSASSSIPFDASQIVKNSYNGDEVDHLVHQMRTKLNQPADTSPSIVQYPRRQAPDSSRANYSATTSTSFSSSTTRKIMNINICVGCGKEITGDQPGCNAMNQIFHVDCFKCGQCSKTLAGASFYNIDDKPTCEGCYQNSLEKCTACNRAISDKLLRACGGVYHVNCFVCFSCKKSLDGIPFTLDKDNNVHCVPCFHDKFAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST 05417BEEBF2292EA glh1_caeel ATP-dependent RNA helicase glh-1 Germline helicase 1 glh-1 T21G5.3 protein protein caeel Caenorhabditis elegans MSDGWSDSESAAKAKTGFGSGGGFGGGNNGGSGFGGGKNGGTGFGGGNTGGSGFGGGNTGGSGFGGGKTGGSGFGGGNTCGSGFGGGSTGGSPYGGASSGFGGSTATSGFGSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNSGFGEGGHGGGERNNNCFNCQQPGHRSSDCPEPRKEREPRVCYNCQQPGHTSRECTEERKPREGRTGGFGGGAGFGNNGGNDGFGGDGGFGGGEERGPMKCFNCKGEGHRSAECPEPPRGCFNCGEQGHRSNECPNPAKPREGVEGEGPKATYVPVEDNMEDVFNMQKISEGLMFNKFFDAEVKLTSSEKTVGIKPCKTFAEANLTETMQKNVAHAGYSKTTPIQQYALPLVHQGYDIMACAQTGSGKTAAFLLPIMTRLIDDNNLNTAGEGGCYPRCIILTPTRELADQIYNEGRKFAYQTMMEIKPVYGGLAVGYNKGQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIETIVNYDSMPRKENRQTLMFSATFPDSVQEAARAFLRENYVMIAIDKIGAANKCVLQEFERCERSEKKDKLLELLGIDIDSYTTEKSAEVYTKKTMVFVSQRAMADTLASILSSAQVPAITIHGAREQRERSEALRQFRNGSKPVLIATAVAERGLDIKGVDHVINYDMPDNIDDYIHRIGRTGRVGNSGRATSFISEDCSLLSELVGVLADAQQIVPDWMQGAAGGNYGASGFGSSVPTQVPQDEEGW 956CADE2937A1725 glh4_caeel ATP-dependent RNA helicase glh-4 Germline helicase 4 glh-4 T12F5.3 protein protein caeel Caenorhabditis elegans MSFSDDGWGAEAEVKVAEDVPEKNVPPPVEPPRAPQSTAIKTEPERNSDEPSAGFGIDPITTSKTFGSQTTPKTEFGGAPSLSGFGGNAAAAAANKTSFDQQGNGFGGAAKHGFGGVGGAPSSFGANVIPVNKPSLGHKTTGFGGEPKHVSGGAFSSANNFDQQDKGFGGAASSGFGNGSMLTNQKVGLENQTTGVGASEVPTSKPSSFGQQPAVVSGFGGAAKMGFGGSSSSGFGGQKAGATESSGFPTKETSTSQPGFGGDSSTGFGSGLKAGFGGHGAGAAENSGLPTETTGFGGKLPSAGFGASSSNESAFGQQSKGFGGATKNGFGGDSSSSFGSGSKAGFGGTSSSGIGGQKPGATESSGFPTKETSTSGGTFGSGFGGKPTSTGFGAPSTTDSSSGQQTAGFGGASKPGFGGDSSTGFGSGLKAGFGGHRASTAENSGLPTETTGFGGKLPPAGFGASSSNESAFGQQSKGFGGATKNGFGGDSSNSFGKRDSGFGGPQDQGFGDTDAPSKSGLGSFNTGGGAVKSAFGAAGFGSSSNFGNGNTFGEPSDNQRGNWDGGERPRGCHNCGEEGHISKECDKPKVPRFPCRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAVDCDQPKVPRGPCRNCGQEGHFAKDCQNERVRMEPTEPCRRCAEEGHWGYECPTRPKDLQGNFLESYDFVFTPDDKMFEDAVNNDDKIDFDQKVVASTGKVEIPDMASFDGFKILPQDLHDNLKRMKMNRPTPIQRASFFPIMHGNDVVACAHTGSGKTLAFLIPFVIKLMEEFEKDRDVTDEKPSPRLLIVAPTRELVNQTFTTARQLTYETGLKCGLAFGGYSRNANVQHLRSFSQLNILVATMGRLQDFVNAGEVSLSKMKYIVLDEADRMVDSNDFGEEVSKIIGSPGERTQQTVLFSASFSEDLQSDDLPKFVKEGYTMLQVDKFGTANEKIDQKILPVPRTEKRDAIYKLLGIDENTVTLLPDAPIEKQKTLIFVNSVKFCDTLAALISSAGVSTISMHSYQNQEQRDRTLDDFRRGKYQCMVASNVCARGLNIAGLDHVVNYDMPDKNGFDEYVNRIGRTGRAGFTGTSTAFVDVENDTDIIPCLVSILNEAKKEVPEWLTEGAGHQEEGGDDWNEQEQEW 698829D125F81064 kgb1_caeel GLH-binding kinase 1 kgb-1 T07A9.3 protein protein caeel Caenorhabditis elegans MEVDLPVHNEYDASRFHQVTIRDPIAGADSTFTIPTRYVNLSFLNAGAQGTVVMADDLVTTQRVAIKKMQQPFVMTMSAKRAYREFILLTTIKHPNIIRLLNAFTPDTSLSTFREVYLVMELMTHNLHEVIHRLRLDHKTLSFFVYQSLCAIKHLHNSGVIHRDLKPSNIVVNDRCVLKVLDFGLARKKNVDTSMRMSDYVVTRYYRAPEVILGLPYSEKVDIWSVGCIFAEMINHTVLFPGKDRIDQWTKIYSVLGTPDDHFISQLGQSAAMYVRSLPRHQARAFSEIVPDTNFLPETENPRVHLTPHVARDLLFNMLKINPEERYSVEDALNHPYVKLWFKDDEVNAPASENRYDQEIDFADKTLIEWKELIFNEVQRYQADHDIFTG B3F09B5229C31A53 glh2_caeel ATP-dependent RNA helicase glh-2 Germline helicase 2 glh-2 C55B7.1 protein protein caeel Caenorhabditis elegans MSDDWDNNTAAAKTISFGSNPSGFGGGSGFGSGNTGGFGSGNAGGTGFGSSNNGGSGFGGNNNVGPRFGNGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGGGNAGGTGFGSGNAGGTGLGSGNAGGTGFGSGNAGGTGFGSGNAGGTGFGSGKAGGTGFGSGKAGGTGFGGNSNSGSGFGSGLTNGFGSGNNHESGFGGGKSGGFGGGNSGGSGFGSGGNSNGFGSGGGGQDRGERNNNCFNCQQPGHRSNDCPEPKKEREPRVCYNCQQPGHNSRDCPEERKPREGRNGFTGGSSGFGGGNGGGTGFDSGLTNGFGSGNNGESGFGSGGFGGNSNGFGSGGGGQDRGERNNNCFNCQQPGHRSNDCPEPKKEREPRVCYNCQQPGHNSRDCPEERKPREGRNGFTSGFGGGNDGGFGGGNAEGFGNNEERGPMKCFNCKGEGHRSAECPEPPRGCFNCGEQGHRSNECPNPAKPREGAEGEGPKATYVPVEDNMEEVFNMQKISEGLMFNKFFDAEVKITSDKKPVGVKTCKTFSEANLGETMKKNVAHAGYTKTTPIQQYTLPLIHQGHDIMACAQTGSGKTAAFLLPIMARLIDENDLNTAGEGGCYPRCIILTPTRELTDQIYNEGRKFAYQTMMEIRPVYGGLAVGYNKGQIEKGATIIVGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTLMFSATFPDSVQEAARNHLKEGYIMLAIDKIGAANKCVLQEFEKCDRSEKKDKLLEILGIDIDSYTTEKNSEVYTKKTIVFVSQRAMADTLASILSSAQVPAITIHGAREQRERSEALRQFRNGSKPVLIATAVAERGLDIKGVDHVINYDMPDNIDDYIHRIGRTGRVGNAGRATSFISEDCNLLSELVRVLSDADQLVPEWMQGASGGNFGASFGFESSVPTQKQDEDCW 13225A843BFEBFA1 glh3-csn5-1 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig 3 glh3-kgb1-1 2 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Fig 3 glh3-zyx1-1 2 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig 3 glh1-csn5-1 2 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey physical association physical association Fig 3 snf1-snf4-4 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig 3 csn5-glh1-1 3 9 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4A csn5-glh3-1 3 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4A kgb1-glh3-1 3 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4B kgb1-glh1-1 3 9 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4B kgb1-glh2-1 3 12 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4B kgb1-glh4-1 3 10 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4B glh1-zyx1-2 3 9 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4C glh3-zyx1-2 3 5 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4C glh1-glh1-1 3 9 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D glh1-glh3-1 3 9 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D glh3-glh1-1 3 5 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D glh3-glh3-1 3 5 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D glh2-glh2-1 3 12 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D glh2-kgb1-1 3 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 4D csn5-glh1-2 1 9 unspecified role unspecified role prey prey caeel Caenorhabditis elegans 6 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig 5B