IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification and characterization of the Escherichia coli stress protein UP12, a putative in vivo substrate of GroEL. Identification and characterization of the Escherichia coli stress protein UP12, a putative in vivo substrate of GroEL. Eur. J. Biochem. (0014-2956) 2002 imex curation Bochkareva ES., Girshovich AS., Bibi E. 10-25% sucrose gradient prepared and after preparative centrifugation Analytical ultracentrifugations were carried out using 1.4 mL of a linear 5-20% sucrose gradient. To identify the proteins in the complex the proteins were dissociated from the GroEL complex by ATP, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. elena.bochkareva@weizmann.ac.il 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bochkareva ES., Girshovich AS., Bibi E. 10-25% sucrose gradient prepared and after preparative centrifugation Analytical ultracentrifugations were carried out using 1.4 mL of a linear 5-20% sucrose gradient. To identify the proteins in the complex the proteins were dissociated from the GroEL complex by ATP, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. elena.bochkareva@weizmann.ac.il Accepted 2008-NOV-20 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. Eur. J. Biochem. (0014-2956) 2002 orchard Only protein-protein interactions imex curation Identification and characterization of the Escherichia coli stress protein UP12, a putative in vivo substrate of GroEL. Identification and characterization of the Escherichia coli stress protein UP12, a putative in vivo substrate of GroEL. Eur. J. Biochem. (0014-2956) 2002 imex curation Bochkareva ES., Girshovich AS., Bibi E. 10-25% sucrose gradient prepared and after preparative centrifugation Analytical ultracentrifugations were carried out using 1.4 mL of a linear 5-20% sucrose gradient. To identify the proteins in the complex the proteins were dissociated from the GroEL complex by ATP, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. elena.bochkareva@weizmann.ac.il 14-Nov-2008: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) density sedimentation cosedimentation through density gradient density sedimentation protein sequence protein sequence identification protein sequence Bochkareva ES., Girshovich AS., Bibi E. 10-25% sucrose gradient prepared and after preparative centrifugation Analytical ultracentrifugations were carried out using 1.4 mL of a linear 5-20% sucrose gradient. To identify the proteins in the complex the proteins were dissociated from the GroEL complex by ATP, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. elena.bochkareva@weizmann.ac.il Accepted 2008-NOV-20 by ORCHARD. Eur. J. Biochem. (0014-2956) 2002 orchard Only protein-protein interactions imex curation ch60_ecoli Chaperonin GroEL groEL 60 kDa chaperonin Chaperonin-60 GroEL protein groL mopA JW4103 b4143 protein protein ecoli Escherichia coli (strain K12) MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGGMGGMGGMM CD3A0FB505F74AD1 CD3A0FB505F74AD1 gaty_ecoli D-tagatose-1,6-bisphosphate aldolase subunit GatY gatY b2096 JW5343 D-tagatose-bisphosphate aldolase class II Tagatose-bisphosphate aldolase yegF protein protein ecoli Escherichia coli (strain K12) MYVVSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTENLLALVSAMAKQYHHPLAIHLDHHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEVVDFCHRFDVSVEAELGQLGGQEDDVQVNEADALYTNPAQAREFAEATGIDSLAVAIGTAHGMYASAPALDFSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFSQALKNYLTEHPEATDPRDYLQSAKSAMRDVVSKVIADCGCEGRA D414AA3921BBFE2B D414AA3921BBFE2B uspg_ecoli Universal stress protein UP12 ybdQ yzzU Universal stress protein G uspG b0607 JW0600 protein protein ecoli Escherichia coli (strain K12) MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSASLSLHRFAADVRRFEEHLQHEAQERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR DIP protein P39177 original sequence version: 76 DIP protein P39177 original sequence version: null 9BF5F7E7BBD51467 grol-uspg 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association 1 and 2 Briefly, after their dissociation from the GroEL complex, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. The amino-acid sequences of proteins X and Y were identified in the Swiss-Prot databank as GatY and UP12 grol-uspg-1 1 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 3 Co-immunoprecipitation of UP12 with GroEL from cell extracts.