IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. Mol. Biol. Cell (1059-1524) 2002 imex curation Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided The protein extract in this study was from a CSN1 (P45432) deficient mutant arabidopsis line which also contained an construct expressing the c-terminal region (211-441) of the CSN1 (P45432) protein. Accepted 2008-APR-18 by JYOTI. Mol. Biol. Cell (1059-1524) 2002 Only protein-protein interactions imex curation CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. Mol. Biol. Cell (1059-1524) 2002 imex curation Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided Accepted 2008-APR-18 by JYOTI. Mol. Biol. Cell (1059-1524) 2002 Only protein-protein interactions imex curation CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. Mol. Biol. Cell (1059-1524) 2002 imex curation Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided The protein extract in this study was from a CSN1 (P45432) deficient mutant arabidopsis line. Accepted 2008-APR-18 by JYOTI. Mol. Biol. Cell (1059-1524) 2002 Only protein-protein interactions imex curation CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. CSN1 N-terminal-dependent activity is required for Arabidopsis development but not for Rub1/Nedd8 deconjugation of cullins: a structure-function study of CSN1 subunit of COP9 signalosome. Mol. Biol. Cell (1059-1524) 2002 imex curation Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Wang X., Kang D., Feng S., Serino G., Schwechheimer C., Wei N. No contact email provided Accepted 2008-APR-18 by JYOTI. Mol. Biol. Cell (1059-1524) 2002 Only protein-protein interactions imex curation csn7_arath COP9 signalosome complex subunit 7 Protein FUSCA 5 FUS5 At1g02090 T7I23.24 T7I23.25 CSN7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKGDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR CBBDA06097E44689 csn1_arath COP9 signalosome complex subunit 1 Constitutive photomorphogenesis protein 11 Protein FUSCA 6 CSN1 COP11 FUS6 At3g61140 T20K12.40 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL C2A980E744B23A90 csn2_arath COP9 signalosome complex subunit 2 Protein FUSCA 12 CSN2 FUS12 At2g26990 T20P8.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASDADMEDYGFEYSDEEQEEQDVDIENQYYNSKGMVETEPEEALSGFAEVVQMEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCNIWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQLYHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFERILKSNRRTIMDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDVTELLVSLILDSRIDGHIDEMNRYLLRGDSGNGRKLHKAVDKWNSQLKSLSSNITSRVC 6B0801CDA31D8A48 csn8_arath COP9 signalosome complex subunit 8 Constitutive photomorphogenesis protein 9 Protein FUSCA 7 CSN8 COP9 FUS7 At4g14110 dl3095c protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH D182ABACE4238759 csn4_arath COP9 signalosome complex subunit 4 Constitutive photomorphogenesis protein 8 Protein FUSCA 4 CSN4 COP8 FUS4 At5g42970 MBD2.17 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV 1E8AEF28C35B28F0 csn4-csn7-csn8 4 8 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association Figure 1 We examined the gel filtration profiles of CSN4, CSN5, CSN7, and CSN8 in the crude extract of fus6 by immunoblots. Whereas the wildtype extract contains all four subunits in the fractions corresponding to CSN complex of 500 kDa (Figure 1, marked by asterisks), the fus6 mutant lacks this 500-kDa peak for all of the subunits examined. The antibody used to detect the CSN5 protein did not appear to distinguish between CSN5A or CSN5B, therefore it was not possible to unambiguously identify the protein referred to by the authors as CSN5. This protein was nor curated into the dataset above. csn4-csn7-1 3 5 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Figure 1 Instead, most of CSN4 and CSN7 are in the fractions of 250-300 kDa, and a small portion is in the fraction corresponding to the monomeric size This interaction was observed in protein extracts from a CSN1 deficient mutant line. csn1-csn2 2 6 unspecified role unspecified role bait bait P45432:p.Gly222Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:29:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly222arg' Tue Jun 30 17:28:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly222Arg' 7 unspecified role unspecified role prey prey physical association physical association Figure 3A Point mutation in fus6-T236 disrupts CSN1 interactions with CSN2 and CSN4 in a yeast-two-hybrid assay. csn2-csn1 2 6 unspecified role unspecified role prey prey P45432:p.Gly222Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:39:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly222arg' Tue Jun 30 18:26:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly222Arg' 7 unspecified role unspecified role bait bait physical association physical association Figure 3A Point mutation in fus6-T236 disrupts CSN1 interactions with CSN2 and CSN4 in a yeast-two-hybrid assay. csn4-csn1-1 2 6 unspecified role unspecified role prey prey P45432:p.Gly222Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:01:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly222arg' Tue Jun 30 19:42:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly222Arg' 9 unspecified role unspecified role bait bait physical association physical association Figure 3A Point mutation in fus6-T236 disrupts CSN1 interactions with CSN2 and CSN4 in a yeast-two-hybrid assay. csn4-csn7-2 4 9 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association Figure 6F csn4-csn7-csn8-1 1 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component physical association physical association Figure 6F The authors conclude that " C231 fragment is able to rescue the complex (CSNS1-C231) formation".