UniProt UniProt http://www.uniprot.org Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Biochim. Biophys. Acta (0006-3002) 2001 imex curation Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. orchard Only protein-protein interactions dicdi Dictyostelium discoideum (Slime mold) Slime mold pull down pull down western blot western blot Immuno blot Immuno blot Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. Biochim. Biophys. Acta (0006-3002) 2001 orchard Only protein-protein interactions imex curation Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Biochim. Biophys. Acta (0006-3002) 2001 imex curation Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. Biochim. Biophys. Acta (0006-3002) 2001 orchard Only protein-protein interactions imex curation Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Biochim. Biophys. Acta (0006-3002) 2001 imex curation Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. orchard Only protein-protein interactions schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. Biochim. Biophys. Acta (0006-3002) 2001 orchard Only protein-protein interactions imex curation Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Biochim. Biophys. Acta (0006-3002) 2001 imex curation Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. Biochim. Biophys. Acta (0006-3002) 2001 orchard Only protein-protein interactions imex curation Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Cyclophilins of a novel subfamily interact with SNW/SKIP coregulator in Dictyostelium discoideum and Schizosaccharomyces pombe. Biochim. Biophys. Acta (0006-3002) 2001 imex curation Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Skruzny M., Ambrozkova M., Fukova I., Martinkova K., Blahuskova A., Hamplova L., Puta F., Folk P. dicty@mbox.cesnet.cz Accepted 2008-OCT-22 by ORCHARD. 16-Oct-2008: Contacted by JYOTI. D. discoideum cDNA library from 8h-16h of development. Biochim. Biophys. Acta (0006-3002) 2001 orchard Only protein-protein interactions imex curation cype_dicdi Peptidyl-prolyl cis-trans isomerase cypE cypE Cyclophilin cypE DDB_G0269216 Rotamase cypE protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTEQTVTLQTTVGDITLELYYNHAPKACKNFYELSKRGYYDNTIFHRLIKDFMIQGGDPLGNGRGGESIYGKKFEDEITKELKHTGAGILSMANSGVNSNGSQFFITFGPTPWLDGKHTIFGRVKSGMKVVQKMNAMQTNNDKPIDEIRIIKATAN D0E02E03DBA06DA3 prp45_schpo Pre-mRNA-processing protein 45 prp45 snw1 SPCC188.11 SPCC584.08 cwf13 Complexed with cdc5 protein 13 Transcriptional coregulator snw1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MALLSEELSSILPNPDFDDEEEDYVERETSHADERQIGVKFHIPPYGQRKGWFPSSPEDFGDGGAFPEIHVAQYPLDMGRKRSAKSAGNTLALQVTSSGAVDYNAIARQGHEHGELVQASFRDLIPLRARLGVGEISLEKPSDEQKQEVANKTKLALQKILSKQIAQSQPKSAVVQQRDDPVYIRYTPSNQMGQALSKQRIIKMVTAEQDPMEPPKFRHKKVPRGPPSPPPPVLHSPPRKVSAQEQQDWQIPPSISNWKNPKGYTIPLDKRLAADGRGLNDVEINDGFAKFSEALYTVERQAREEVRYRAIMRQKMAEKEKQEKEQRLFMLAQKAREDRMGRNAASSGPSHAKPRSTSVSSEERSRSRAGSFSHHSESENEDEDSEAFRRRQELRRERRRQAEKDLRLSRMGAEKRAKLAEKDRPRDVAERVALGLSKPSMSSDTMIDSRLFNQASGLGSGFQDEDSYNVYDKPWRAAPSSTLYRPGATLSRQVDASAELERITSESRYDVLGNAHKKFKGSDEVVESRAGPVTFEKDIADPFGVDTFLNNVSSKKT 916673DA5F9FE192 snwa_dicdi Protein snwA snwA DDB_G0269188 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTSLSSLLPKPKNVYSNEEEDPLFQPKPKPQQQKQQQQQQQELNDKPKKVIPTYGNRKGYLPKNIEDFGDGGAFPEIHIVQYPLDMGRKGKSKSSNSNTSNMNGGGTTTSIVPVSVDSTGRVKHEAILGEKGSLHSQYKDLIPKQHTEHELQRPDDDELQETLDRTKNALEKIVNGKIKSSKSTNYVEVEKKSATYIKYTPSNQLGSNNGSALNSKIVRMVDVAQDPLEPPKYKIKKKIMEHGSPPAPVMHSPTRKLSVQDQQDWTIPPCVSNWKNPKGFAISIDKRLVSNGGGLQDVEINDKFAHFTQALYIAESNAREEVSARAELERKLAQKEKERKQDMLRKLAEDVRNERSGIIQQRYTRKDNSDSDNDNDNDSSSDEDKNKRTPPMNRRSRSRSTERIPSRNDNDDDDDRYRIKDNRDNRGRDNIDSRDNRDSRDSRDSRDSRDSRDSRDSRDNRDSRDSRDNRDNRDNRRRDDSNDRDRYSKRRSDSDSDSDSDSSDSEDERVRRERKEKLERDKIRMEKKRELEREYRLEASGKKSKFNRDQDRDISEKIALGQASIKRTEDSIYDQRLFNQSESLTSGFGNDDSYNVYSKPLFGGAVSNSIYRPKSNQEDNTSIQDVLSNSRFGKEGGSGSGGVPRPNKEFSGTDRSKDRTGPVAFEKEKKKSDDPFGFDDFSKKR 1DC8521E9997A583 ppil1_schpo Peptidyl-prolyl cis-trans isomerase ppi1 ppi1 cyp2 Cyclophilin ppi1 SPAC57A10.03 Rotamase ppi1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MANVELQTSLGKILIELYTEHAPKTCQNFYTLAKEGYYDGVIFHRVIPDFVIQGGDPTGTGRGGTSIYGDKFDDEIHSDLHHTGAGILSMANAGPNTNSSQFFITLAPTPWLDGKHTIFGRVVSGLSVCKRMGLIRTDSSDRPIEPLKIIKAVAL E3D1640E30486D21 snwa-cype-1 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association We screened the Dictyostelium discoideum two-hybrid cDNA library with the SNW/SKIP transcription coregulator SnwA and identified a novel cyclophilin CypE. snwa-cype-2 4 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1A cype-snwa-1 4 6 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1A prp45-ppi1-1 4 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 1B prp45-ppi1-2 5 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Independently, the Schizosaccharomyces pombe cDNA library was screened with the SnwA ortholog Snw1 and the ortholog of CypE (named Cyp2) was found. cype-snwa-2 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 3A nd the His-CypE dependent precipitation of endogenous SnwA was identified by 8% Tris-glycine sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) using anti-SnwA antibody (Fig. 3A a snwa-cype-3 1 8 unspecified role unspecified role bait bait c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 3B His-tagged SnwA coprecipitates myc-tagged CypE in a colysis experiment in Dictyostelium. prp45-ppi1-3 3 9 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait n-terminus myc-his tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 3C prp45-ppi1-4 3 9 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey n-terminus myc-his tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig 3D