IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel UDP-glucose transferase is part of the callose synthase complex and interacts with phragmoplastin at the forming cell plate. A novel UDP-glucose transferase is part of the callose synthase complex and interacts with phragmoplastin at the forming cell plate. Plant Cell (1040-4651) 2001 Hong Z., Zhang Z., Olson JM., Verma DP. verma.1@osu.edu 14-May-2008: Contacted by JYOTI. Arabidopsis cDNA library, made from mRNAs of 6- to 8-day-old seedlings. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hong Z., Zhang Z., Olson JM., Verma DP. verma.1@osu.edu Accepted 2008-MAY-23 by CDEROW. 14-May-2008: Contacted by JYOTI. Arabidopsis cDNA library, made from mRNAs of 6- to 8-day-old seedlings. Plant Cell (1040-4651) 2001 A novel UDP-glucose transferase is part of the callose synthase complex and interacts with phragmoplastin at the forming cell plate. A novel UDP-glucose transferase is part of the callose synthase complex and interacts with phragmoplastin at the forming cell plate. Plant Cell (1040-4651) 2001 Hong Z., Zhang Z., Olson JM., Verma DP. verma.1@osu.edu 14-May-2008: Contacted by JYOTI. Arabidopsis cDNA library, made from mRNAs of 6- to 8-day-old seedlings. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hong Z., Zhang Z., Olson JM., Verma DP. verma.1@osu.edu Accepted 2008-MAY-23 by CDEROW. 14-May-2008: Contacted by JYOTI. Arabidopsis cDNA library, made from mRNAs of 6- to 8-day-old seedlings. Plant Cell (1040-4651) 2001 u75b1_arath UDP-glycosyltransferase 75B1 UGT75B1 At1g05560 UGT1 IAA-Glu synthase 1 (Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase 1 Indole-3-acetate beta-glucosyltransferase 1 T25N20.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPPHFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVENLSFLTFSDGFDDGGISTYEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNWAPKVARRFQLPSALLWIQPALVFNIYYTHFMGNKSVFELPNLSSLEIRDLPSFLTPSNTNKGAYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNIDMVAVGPLLPTEIFSGSTNKSVKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVMEEKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVEDICGESLIQNLCEAEEVKVK 77C6088342C78D76 rac11_arath Rac-like GTP-binding protein ARAC11 GTPase protein ROP1 ARAC11 ROP1 F24M12.340 At3g51300 RAC11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL DAF48ED8D3051AC5 sdlca_soybn Dynamin-related protein 12A Soybean dynamin-like protein 12A Phragmoplastin protein protein soybn Glycine max (Soybean) Glycine hispida MENLISLVNKIQRACTALGDHGENSALPTLWDSLPAIAVVGGQSSGKSSVLESVVGKDFLPRGSGIVTRRPLVLQLHKIDEGSREYAEFLHLPRKRFTDFVAVRKEIQDETDRETGRTKQISSVPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPDSIVKDIEDMVRSYIEKPNCIILAISPANQDLATSDAIKISREVDPTGDRTIGVLTKIDLMDKGTDAVDILEGRAYRLKFPWIGVVNRSQQDINKNVDMIAARRREREYFNSTPEYKHLANRMGSEHLAKMLSKHLETVIKSKIPGIQSLINKTIAELEAELTRLGKPVAADAGGKLYAIMEICRSFDQIFKDHLDGVRPGGDKIYNVFDNQLPAALKRLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSLITIRGPAESAVDAVHSLLKDLVHKAMSETLDLKQYPGLRVEVGAASVDSLERMRDESKRATLQLVDMECGYLTVDFFRKLPQDVDKGGNPTHSICDRYNDSYLRRIGTTILSYVNMVCATLRHSIPKSIVYCQVREAKRSLLDHFFTELGKMEIKRLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDAVAWSK 62AF611E6A615F15 sdl12a-at1g05560 1 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association The authors state that the seauence of the isolated cDNA clone "lacked 600 bp at the 5' terminus". Figure 1A Both controls were negative in the 5-bromo-4-chloro-3-indolylb-D-galactopyranoside (X-Gal) assay (Figure 1A), suggesting that the presence of both phragmoplastin and the UGT1 proteins encoded by pPIL33 is required for the observed interactions. sdl12a-at1g05560-1 2 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Figure 1B The coding region of pUGT1f was cloned downstream from the glutathione S-transferase (GST) coding region, and the fusion protein was expressed in Escherichia coli and purified using glutathione�agarose beads. The SA2 domain of phragmoplastin was labeled with 35S-methionine in an in vitro transcription/translation system (Zhang et al., 2000). The radiolabeled phragmoplastin peptide was pulled down effectively by the recombinant fusion protein (Figure 1B), suggesting that the interaction between the phragmoplastin and UGT1 also occurs under in vitro conditions and that no additional protein is required for this interaction. The coordinates for the SA2 reigon of the Phragmoplastin protein were obtained from the reference Zhang et al 2000 provided in the text. rop1-at1g05560-2 2 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3B When UGT1 was fused to GST and purified with the beads, it interacted quantitatively with 35S-labeled Rop1 and brought down the radiolabeled product to the pellet