IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Possible His to Asp phosphorelay signaling in an Arabidopsis two-component system. Possible His to Asp phosphorelay signaling in an Arabidopsis two-component system. FEBS Lett. (0014-5793) 2000 Urao T., Miyata S., Yamaguchi-Shinozaki K., Shinozaki K. kazukoys@jircas.affrc.go.jp 27-Aug-2008: Contacted by JYOTI. jyoti yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Urao T., Miyata S., Yamaguchi-Shinozaki K., Shinozaki K. kazukoys@jircas.affrc.go.jp Accepted 2008-AUG-9 by JYOTI. FEBS Lett. (0014-5793) 2000 jyoti ahp1_arath Histidine-containing phosphotransfer protein 1 AHP1 ATHP3 At3g21510 MIL23.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF BA0C026EA19AF83D arr9_arath Two-component response regulator ARR9 ARR9 ATRR4 At3g57040 F24I3.120 Response reactor 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGMAAESQFHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQSTDSNDPNAFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLKNQKLEEIETTSKVENGVPTAVADPEIKDSTNIEIEILPLQQDLLLVQQEEQTLSINNKRKSVEEGISTDRARPRFDGIATAV 489D89364F8585FC cki1_arath Histidine kinase CKI1 CKI1 At2g47430 Protein CYTOKININ-INDEPENDENT 1 T30B22.27 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMVKVTKLVASRPIVVFCVLAFLVVVFECIWISNWRTTTENLVKEVASFTEDLRTSLVSEIENIGKFTYAKTNLSTIGLARVIDSYITNNDTGFTEIQTQIAPLLFVAYSTILQVSQVSYISRDGLMFSYIAESNTSVAVFANSSSNSSRGDYTWYTQTVDQLTGRLNGNSTKSQSLDVTHTDWFQAAQSNNYTTAFVGTSLGGEDNETLIQSVVSLYSKKGLVSLGFPVKTLTEVLNSLNLHGEELYMWTKDGTVLVREGSLNDSFFISNGSICFGRESNSLWSQCIPENCSSSGYEVEIKRLRYQAFCSVIEVSGVPLRYTLMFPNKGGATRIKHQAEKAKYQLIVVMIFLGFGWPVWFVWFMMQATRREMHMRATLINQMEATQQAERKSMNKSQAFANASHDIRGALAGMKGLIDICRDGVKPGSDVDTTLNQVNVCAKDLVALLNSVLDMSKIESGKMQLVEEDFNLSKLLEDVIDFYHPVAMKKGVDVVLDPHDGSVFKFSNVRGDSGRLKQILNNLVSNAVKFTVDGHIAVRAWAQRPGSNSSVVLASYPKGVSKFVKSMFCKNKEESSTYETEISNSIRNNANTMEFVFEVDDTGKGIPMEMRKSVFENYVQVRETAQGHQGTGLGLGIVQSLVRLMGGEIRITDKAMGEKGTCFQFNVLLTTLESPPVSDMKVRQEIEAGGDYVSTPNLGLTINTSLGGSMNIRNLSPRFNNCLSSSPKQEGSRVVLLLKNEERRRVTEKYIKNLGIKVTVVEKWEHLSYALERLFGFSPQSSMGRAECSLSCPSSRELPFIGMDGIDSRSQLPKRRSISFSAVVLLVIDAKTGPFFELCDIVKQFRRGLPHGISCKVVWLNESSTRVSERGDISCSRPLHGSRLMEVLKMLPEFGGTVLKEPPTELQRESLLRHSFVAERSPKHKVQEEGPSSMFNKKLGKRIMASTDSESETRVKSVRTGRKPIGNPEDEQETSKPSDDEFLRGKRVLVVDDNFISRKVATGKLKKMGVSEVEQCDSGKEALRLVTEGLTQREEQGSVDKLPFDYIFMDCQMPEMDGYEATREIRKVEKSYGVRTPIIAVSGHDPGSEEARETIQAGMDAFLDKSLNQLANVIREIESKRH C6833F731DA84781 ahk1_arath Histidine kinase 1 AHK1 Arabidopsis histidine kinase 1 Protein AUTHENTIC HIS-KINASE 1 T13L16.16 T17A5 At2g17820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGDSFSMSIENLPDSPMGSRKKKMQIRKVFDKMTEWVTPWRSNLESPREMMILRGDVEQDEFQYASSHCLSSYYSVFVVRLAIMVMLAILIGLLTVLTWHFTRIYTKQSLQTLAYGLRYELLQRPVLRMWSVLNTTSELTTAQVKLSEYVIKKYDKPTTQEELVEMYQAMKDVTWALFASAKALNAITINYRNGFVQAFHRDPASSSTFYIFSDLKNYSISGTGPEDVSGWNNKSIHGNMSAIWYQQQLDPVTGENLGKPLKIPPDDLINIAGISQVPDGEASWHVTVSKYMDSPLLSAALPVFDASNKSIVAVVGVTTALYSVGQLMRDLVEVHGGHIYLTSQEGYLLATSTDGPLLKNTSNGPQLMKATDSEEWVIKSGAQWLEKTYGSKRPHVVHAENVKLGDQRYYIDSFYLNLKRLPIVGVVIIPRKFIMGKVDERAFKTLIILISASVCIFFIGCVCILILTNGVSKEMKLRAELIRQLDARRRAEASSNYKSQFLANMSHELRTPMAAVIGLLDILISDDCLSNEQYATVTQIRKCSTALLRLLNNILDLSKVESGKLVLEEAEFDLGRELEGLVDMFSVQCINHNVETVLDLSDDMPALVRGDSARLVQIFANLISNSIKFTTTGHIILRGWCENINSLHDEMSVSVDRRKPWAPMKTKQVQHRNHLQKSCKNANKMVLWFEVDDTGCGIDPSKWDSVFESFEQADPSTTRTHGGTGLGLCIVRNLVNKMGGEIKVVQKNGLGTLMRLYLILSTPDTVDQNIQPDFSKYGLVVMLSMYGSTARMITSKWLRKHGIATVEASDWNELTQIIRDLLETGSRDNSFDSQHNISDPLRAELSNIVEIKNPVFVIVVDIGVLDLTTNIWKEQLNYLDRFSNKAKFAWLLKHDTSNTVKTELRRKGHVMMVNKPLYKAKMIQILEAVIKNRKRGLCNDLRNRGNGSDESHDCLEIDPTQFDTCSSDDSSETSGEKQVDKSVKPSTLHSPVLKNYLIDATTSNDDSTSASMTQKNPEEEDWKDRLYSGIALDGKNQKSLEGIRILLAEDTPVLQRVATIMLEKMGATVTAVWDGQQAVDSLNYKSINAQAPTEEHKSFEEETANKVTTRETSLRNSSPYDLILMDCQMPKMDGYEATKAIRRAEIGTELHIPIVALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTILSLTKPSAFQTSLSA 2F4471EEFE7C68A3 arr3_arath Two-component response regulator ARR3 ARR3 F23H11.25 At1g59940 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKDGGVSCLRRSEMIGIGIGELESPPLDSDQVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDDDKAAVEFDRLKVDLIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVMTRIDRCLEEGAEDFLLKPVKLADVKRLRSYLTRDVKVAAEGNKRKLTTPPPPPPLSATSSMESSDSTVESPLSMVDDEDSLTMSPESATSLVDSPMRSPGLA CD4950AE87FAFC91 ahp2_arath Histidine-containing phosphotransfer protein 2 AHP2 ATHP1 At3g29350 MUO10.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN 9A8FA1184F0E4462 ahp3_arath Histidine-containing phosphotransfer protein 3 AHP3 ATHP2 At5g39340 MUL8.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTLIAQLQRRFCDFTISLYHQGFLDDQFTELKKLQDECSPDFVAEVVTLFFEDCEKLISNMARALDQTGNVDFKLVGSSVHQLKGSSSSVGAKRVKGLCVTLKECCDSQNYEGCVRCLQQVDIEYKTLKAKLQDLFNLEQQIVQAGGRIPQVDI F3B26DCFA3904E0D sln1_yeast Osmosensing histidine protein kinase SLN1 YIL147C SLN1 YPD2 Osmolarity two-component system protein SLN1 Tyrosine phosphatase-dependent protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKNNK 45FFE24A8165486B 45FFE24A8165486B arr4_arath Two-component response regulator ARR4 Response regulator 1 ARR4 ATRR1 IBC7 At1g10470 T10O24.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARDGGVSCLRRSEMMSVGGIGGIESAPLDLDEVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDNEKASAEFDRLKVDLIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVKLADVKRLRSHLTKDVKLSNGNKRKLPEDSSSVNSSLPPPSPPLTISPESSPPLTVSTESSDSSPPLSPVEIFSTSPLSSPIDDEDDDVLTSSSEESPIRRQKMRSPGLD 557A4E2DA51948F5 etr1_arath Ethylene receptor 1 ETR1 T27F4.9 At1g66340 Protein ETHYLENE RESPONSE 1 Protein ETR1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSGKYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMHAIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLHTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRSSGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPAIPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYEGM D6ED3C4BBA87E96E ahp2-at2g17820 1 5 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9SXL4:p.Asp1075Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D E Wed May 02 17:04:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1075glu' Tue Jun 30 19:35:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp1075Glu' 7 unspecified role unspecified role bait bait physical association physical association Figure 1 The authors state that "to construct expression plasmids ATHK1-RD and ATHK1-RD (D1074E), the receiver domain of ATHK1 (amino acids 961-1207) was amplifed by PCR". However the Uniprot record for this protein is only 1190 amino acids in length and appears to be missing a 17 amino acid sequence at its n-termini (MRGDSFSMSIENLPDSP). The region used in the yeast two hybrid consists of a c-terminal 246 amino acid region, the coordinates for this region are taken from the Uniprot record and differ from that presented by the authors. Therefore, the receiver domain of ATHK1 (ATHK1-RD) and the fulllength coding regions of ATHP1-3 were expressed as fusion proteins to a LexA DNA-binding domain (pLexA) and to a VP16 activation domain (pVP16), and were tested for both growth on His-lacking medium and L-galactosidase activity in yeast. Reciprocal combinations of the pLexA and pVP16 plasmids were also tested to confirm the positive interactions. ATHK1 interacted with ATHP1 The authors concluded "these results suggest that the interaction between ATHK1 and ATHP1 depends on the phosphorylation state of the receiver domain of ATHK1". at2g17820-ahp2 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9SXL4:p.Asp1075Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D E Wed May 02 17:32:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1075glu' Tue Jun 30 18:08:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp1075Glu' physical association physical association Figure 1 The authors state that "to construct expression plasmids ATHK1-RD and ATHK1-RD (D1074E), the receiver domain of ATHK1 (amino acids 961-1207) was amplifed by PCR". However the Uniprot record for this protein is only 1190 amino acids in length and appears to be missing a 17 amino acid sequence at its n-termini (MRGDSFSMSIENLPDSP). The region used in the yeast two hybrid consists of a c-terminal 246 amino acid region, the coordinates for this region are taken from the Uniprot record and differ from that presented by the authors. Therefore, the receiver domain of ATHK1 (ATHK1-RD) and the fulllength coding regions of ATHP1-3 were expressed as fusion proteins to a LexA DNA-binding domain (pLexA) and to a VP16 activation domain (pVP16), and were tested for both growth on His-lacking medium and L-galactosidase activity in yeast. Reciprocal combinations of the pLexA and pVP16 plasmids were also tested to confirm the positive interactions. ATHK1 interacted with ATHP1 The authors concluded "these results suggest that the interaction between ATHK1 and ATHP1 depends on the phosphorylation state of the receiver domain of ATHK1". ahp2-etr1 1 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 As shown in Fig. 2, we detected direct interactions between ETR1 and all ATHPs, etr1-ahp2 1 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 As shown in Fig. 2, we detected direct interactions between ETR1 and all ATHPs, ahp3-etr1 1 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait physical association physical association Figure 2 between CKI1 and ATHP1 or ATHP2. etr1-ahp3 1 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Figure 2 As shown in Fig. 2, we detected direct interactions between ETR1 and all ATHPs, ahp1-etr1-1 1 2 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 As shown in Fig. 2, we detected direct interactions between ETR1 and all ATHPs, etr1-ahp1 1 2 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 As shown in Fig. 2, we detected direct interactions between ETR1 and all ATHPs, ahp2-cki1 1 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Figure 2 between CKI1 and ATHP1 or ATHP2. cki1-ahp2 1 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Figure 2 between CKI1 and ATHP1 or ATHP2. ahp3-cki1 1 8 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 As shown in Fig. 2, we detected direct interactions between ETR1 and all ATHPs, cki1-ahp3 1 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 between CKI1 and ATHP1 or ATHP2. ahp2-sln1 1 9 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Figure 2 We also detected interactions between yeast SLN1 and ATHP1 or ATHP3 sln1-ahp2 1 9 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Figure 2 We also detected interactions between yeast SLN1 and ATHP1 or ATHP3 ahp1-sln1 1 2 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 We also detected interactions between yeast SLN1 and ATHP1 or ATHP3 sln1-ahp1 1 2 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 2 We also detected interactions between yeast SLN1 and ATHP1 or ATHP3 ahp3-arr9 1 3 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 3 We detected interactions between ATHP2 And ATRR4, arr9-ahp3-1 1 3 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Figure 3 We detected interactions between ATHP2 And ATRR4, ahp1-arr9 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Figure 3 We detected interactions between ATHP2 and ATRR4, arr9-ahp1-1 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Figure 3 We detected interactions between ATHP2 and ATRR4, ahp1-arr4 1 10 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Figure 3 We detected interactions between ATHP2 and ATRR4, and between ATHP3 and ATRR1 or ATRR4 arr4-ahp1-1 1 2 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Figure 3 We detected interactions between ATHP2 and ATRR4, and between ATHP3 and ATRR1 or ATRR4 sln1-ahp3 1 9 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Figure 2 ahp2-arr9 1 7 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 3A ahp3-arr3-1 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 3 ahp1-arr3-2 1 6 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Figure 3