UniProt UniProt http://www.uniprot.org Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Mol. Biol. Cell 11 (2445-2457) 2000 imex curation Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu Accepted 2008-Not a month!-2 by DAVET. 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. Mol. Biol. Cell 11 (2445-2457) 2000 davet Only protein-protein interactions imex curation Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Mol. Biol. Cell 11 (2445-2457) 2000 imex curation Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu Accepted 2008-Not a month!-2 by DAVET. 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. Mol. Biol. Cell 11 (2445-2457) 2000 davet Only protein-protein interactions imex curation Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Mol. Biol. Cell 11 (2445-2457) 2000 imex curation Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast confocal microscopy confocal microscopy predetermined predetermined participant predetermined Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu Accepted 2008-Not a month!-2 by DAVET. 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. Mol. Biol. Cell 11 (2445-2457) 2000 davet Only protein-protein interactions imex curation Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Nucleus-vacuole junctions in Saccharomyces cerevisiae are formed through the direct interaction of Vac8p with Nvj1p. Mol. Biol. Cell 11 (2445-2457) 2000 imex curation Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pan X., Roberts P., Chen Y., Kvam E., Shulga N., Huang K., Lemmon S., Goldfarb DS. dasg@uhura.cc.rochester.edu Accepted 2008-Not a month!-2 by DAVET. 16-Dec-2008: Contacted by JYOTI. Yeast cDNA library. Mol. Biol. Cell 11 (2445-2457) 2000 davet Only protein-protein interactions imex curation vac8_yeast Vacuolar protein 8 VAC8 YEB3 YEL013W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGSCCSCLKDSSDEASVSPIADNEREAVTLLLGYLEDKDQLDFYSGGPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRQVSREVLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANILDALIPMTFSQNQEVSGNAAAALANLCSRVNNYTKIIEAWDRPNEGIRGFLIRFLKSDYATFEHIALWTILQLLESHNDKVEDLVKNDDDIINGVRKMADVTFERLQRSGIDVKNPGSNNNPSSNDNNSNNNDTGSEHQPVEDASLELYNITQQILQFLH B2E75774B47E5933 B2E75774B47E5933 vab2_yeast Biogenesis of lysosome-related organelles complex 1 subunit VAB2 VAB31 VAB2 VAC8-binding protein 2 YEL005C protein protein yeast Saccharomyces cerevisiae Baker's yeast MVADLTKGILKWKSRIEFDAVGSSSYYEELKGLPPLASHKKLTQAAIFNSTKYELLQVKKDILSIYEVVSRDIDEERNQMQQIELQLKKSLKKVEHSYKNVLKQRASTNCINGNDRLLANAEKKIGSLNEELACVNDIVSDIVNNLTALNANLPKKAQLLKDDSINVAHYPLLFDFLHKSCPKSIIATSEASIHENASPSPLLEHDELPAESINSFYGENELQSDSLAPLQTHDDNISSCKKILPPKFNTTSGPSIETNFENISADGLTYTKCSLKNSISLT 8F7CA122F91E491A 8F7CA122F91E491A atg13_yeast Autophagy-related protein 13 ATG13 APG13 YPR185W protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAEEDIEKQVLQLIDSFFLKTTLLICSTESSRYQSSTENIFLFDDTWFEDHSELVSELPEIISKWSHYDGRKELPPLVVETYLDLRQLNSSHLVRLKDHEGHLWNVCKGTKKQEIVMERWLIELDNSSPTFKSYSEDETDVNELSKQLVLLFRYLLTLIQLLPTTELYQLLIKSYNGPQNEGSSNPITSTGPLVSIRTCVLDGSKPILSKGRIGLSKPIINTYSNALNESNLPAHLDQKKITPVWTKFGLLRVSVSYRRDWKFEINNTNDELFSARHASVSHNSQGPQNQPEQEGQSDQDIGKRQPQFQQQQQPQQQQQQQQQQQRQHQVQTQQQRQIPDRRSLSLSPCTRANSFEPQSWQKKVYPISRPVQPFKVGSIGSQSASRNPSNSSFFNQPPVHRPSMSSNYGPQMNIEGTSVGSTSKYSSSFGNIRRHSSVKTTENAEKVSKAVKSPLQPQESQEDLMDFVKLLEEKPDLTIKKTSGNNPPNINISDSLIRYQNLKPSNDLLSEDLSVSLSMDPNHTYHRGRSDSHSPLPSISPSMHYGSLNSRMSQGANASHLIARGGGNSSTSALNSRRNSLDKSSNKQGMSGLPPIFGGESTSYHHDNKIQKYNQLGVEEDDDDENDRLLNQMGNSATKFKSSISPRSIDSISSSFIKSRIPIRQPYHYSQPTTAPFQAQAKFHKPANKLIDNGNRSNSNNNNHNGNDAVGVMHNDEDDQDDDLVFFMSDMNLSKEG 45CD16F69B795E62 45CD16F69B795E62 nvj1_yeast Nucleus-vacuole junction protein 1 VAB36 NVJ1 YHR195W protein protein yeast Saccharomyces cerevisiae Baker's yeast MTRPPLVRGIFSLGLSVAVLKGVEKTVRKHLERQGWIEPQKVDYELIFTIDRLKNLVDNKREALTAEQPDAGELSWRKVFNFISRQSSELDTRIYVLILLLSFLLPIAWTVLDGDRETTLEDKDNDCNVDLIENERRLKHYNDGERAVLQFGKNRSEPIILSYKDMNVLEGEHEFTSKEEHSNSHLTSKSENALNQVGSEDLLGCHLEKQLEEDKNEPNGEADGEDDNNREKDCSSSSEVESQSKCRKESTAEPDSLSRDTRTTSSLKSSTSFPISFKGSIDLKSLNQPSSLLHIQVSPTKSSNLDAQVNTEQAYSQPFRY 13F54DFE8D1E5875 vac8-apg13 4 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association No figure. vac8-vab2 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association No figure. vac8-nvj1 4 8 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association No figure. nvj1-vac8 2 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1A apg13-vac8 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1B vab2-vac8 2 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C vac8-nvj1-1 1 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 3 vac8-nvj1-2 3 8 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 7 The colocalization is partial.