IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. J. Mol. Biol. (0022-2836) 2000 imex curation Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu Accepted 2009-MAR-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. J. Mol. Biol. (0022-2836) 2000 orchard Only protein-protein interactions imex curation The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. J. Mol. Biol. (0022-2836) 2000 imex curation Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu Accepted 2009-MAR-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. J. Mol. Biol. (0022-2836) 2000 orchard Only protein-protein interactions imex curation The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. J. Mol. Biol. (0022-2836) 2000 imex curation Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu Accepted 2009-MAR-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. J. Mol. Biol. (0022-2836) 2000 orchard Only protein-protein interactions imex curation The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. The anti-sigma factor SpoIIAB forms a 2:1 complex with sigma(F), contacting multiple conserved regions of the sigma factor. J. Mol. Biol. (0022-2836) 2000 imex curation Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu 09-April-2009: Contacted by JYOTI. orchard Only protein-protein interactions ecoli Escherichia coli (strain K12) enzymatic footprint enzymatic footprinting enzymatic footprint ms participant Identification by mass spectrometry ms participant Campbell EA., Darst SA. SDS-PAGE using 8 25 percent PhastGels were used for detection of the complexes. darst@rockvax.rockefeller.edu Accepted 2009-MAR-26 by ORCHARD. 09-April-2009: Contacted by JYOTI. J. Mol. Biol. (0022-2836) 2000 orchard Only protein-protein interactions imex curation sp2ab_geose Anti-sigma F factor spoIIAB Stage II sporulation protein AB protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MRNEMHLQFSARSENESFARVTVAAFVAQLDPTTDELTEIKTVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHLTVRDEGVGIPDIEEARQPLFTTKPELERSGMGFTIMENFMDEVIVESEVNKGTTVYLKKAYCEKQTLCN B3F1BD38A9044416 o32728_geose RNA polymerase sigma factor protein protein geose Geobacillus stearothermophilus Geobacillus stearothermophilus Bacillus stearothermophilus MDVDVKQGQSPIKDQEMKELIRRSQEGDQEARDEIIEKNMRLVWSVVQRFLNRGYEADDLFQIGCIGLLKSVDKFDLSYDVKFSTYAVPMIIGEIQRFLRDDGTVKVSRSLKEMGNKIRKAKDELSKTRGRSPTITEIADHLGISPEDVVLAQEAVRLPTSIHETVYENDGDPITLLDQIADADEASWFDKIALKKAIEELDERERLIVYLRYYRDRTQSEVASRLGISQVQVSRLEKKILQHIKDKMDG D0B9CBC7DDE41465 spoiiab-sigf 2 5 unspecified role unspecified role prey prey n terminal optyr O4'-phospho-L-tyrosine (2S)-2-amino-3-(4-phosphonooxyphenyl)propanoic acid 2-azanyl-3-(4-phosphonooxyphenyl)propanoic acid MOD_RES Phosphotyrosine O4-phosphotyrosine tyrosine phosphate 2-amino-3-(4-hydroxyphenyl)propanoic acid 4'-phosphate O4'-phospho-L-tyrosine O4'-phosphorylated L-tyrosine OPTyr Phospho Phospho Tyrosinyl Phosphorylation phosphorylationy certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait O32728:p.Val233Met Decreases toxicity in E. coli mutation mutation certain certain sequence position certain certain certain sequence position certain V M Wed May 02 17:32:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val233met' Tue Jun 30 16:41:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val233Met' n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1 lane 3, 5 Lane 3 illustrates that SpoIIAB co-purified with His6-σF, suggesting that the complex indeed formed in vivo. spoiiab-sigf-1 1 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1 lane 6-9, 2, table 1, 6 These samples were concentrated (lane 5) and then subjected to gel filtration, which separated SpoIIAB-σF complex (lanes 6�9) Molecular mass = 61.5 kDa spoiiab-sigf-3 3 6 unspecified role unspecified role neutral component neutral component O32728:p.Val233Met Decreases toxicity in E. coli mutation mutation certain certain sequence position certain certain certain sequence position certain V M Wed May 02 16:11:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val233met' Tue Jun 30 19:55:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val233Met' 5 unspecified role unspecified role neutral component neutral component physical association physical association 6 The fit of the absorbance versus radius profile for sedimentation equilibrium corresponds to a single molecular species with a molecular mass of 55.9(�1.0) kDa. This corresponds to a trimer with stochiometry SpoIIAB2:σ1F (calculated molecular MASS=58.1 kDa). spoiiab-sigf-4 4 6 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Figure 3 and Table 2