IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen. Structural basis of plasticity in T cell receptor recognition of a self peptide-MHC antigen. Science (0036-8075) 1998 imex curation Garcia KC., Degano M., Pease LR., Huang M., Peterson PA., Teyton L., Wilson IA. wilson@scripps.edu 07-Aug-2007: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Garcia KC., Degano M., Pease LR., Huang M., Peterson PA., Teyton L., Wilson IA. wilson@scripps.edu Accepted 2007-AUG-25 by ORCHARD. Science (0036-8075) 1998 orchard Only protein-protein interactions imex curation ndua4_mouse Cytochrome c oxidase subunit NDUFA4 Ndufa4 protein protein mouse Mus musculus Mouse MLRQILGQAKKHPSLIPLFVFIGAGGTGAALYVMRLALFNPDVSWDRKNNPEPWNKLGPNEQYKFYSVNVDYSKLKKEGPDF 6E29865845807C7B tcrb_mouse_protein protein protein mouse Mus musculus Mouse EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC An amino acid sequence which is not represented in UniProt The protein sequence in the MSD entry of PMID 8824178 has 89.9 percent identity with the UniProtKb sequence Similar to Q5FW89 2BA83D1E842F1690 ha1b_mouse H-2 class I histocompatibility antigen, K-B alpha chain H2-K1 H2-K protein protein mouse Mus musculus Mouse MVPCTLLLLLAAALAPTQTRAGPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPPSTVSNMATVAVLVVLGAAIVTGAVVAFVMKMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA DIP protein P01901 original sequence version: 139 3D2F125318193443 a2ntu7_mouse protein protein mouse Mus musculus Mouse MLLALLPVLGIHFVLRDAQAQSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPCDATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS 202557AD1A605E39 b2mg_mouse Beta-2-microglobulin B2m protein protein mouse Mus musculus Mouse MARSVTLVFLVLVSLTGLYAIQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHASMAEPKTVYWDRDM DIP protein P01887 original sequence version: 171 94F649EBCF1D7A4E ha1b-b2mg 1 2 unspecified role unspecified role neutral component neutral component peptide region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 The 2C TCR and H-2Kb-dEV8 were expressed and purified from Drosophila melanogaster cells and cocrystallized