UniProt UniProt http://www.uniprot.org Association of elongation factor 1 alpha and ribosomal protein L3 with the proline-rich region of yeast adenylyl cyclase-associated protein CAP. Association of elongation factor 1 alpha and ribosomal protein L3 with the proline-rich region of yeast adenylyl cyclase-associated protein CAP. Biochem. Biophys. Res. Commun. 232 (503-507) 1997 Yanagihara C., Shinkai M., Kariya K., Yamawaki-Kataoka Y., Hu CD., Masuda T., Kataoka T. kataoka@icluna.kobe-u.ac.jp 22-Jan-2008: Contacted by JYOTI. orchard in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yanagihara C., Shinkai M., Kariya K., Yamawaki-Kataoka Y., Hu CD., Masuda T., Kataoka T. kataoka@icluna.kobe-u.ac.jp Accepted 2007-Not a month!-10 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Biochem. Biophys. Res. Commun. 232 (503-507) 1997 orchard Association of elongation factor 1 alpha and ribosomal protein L3 with the proline-rich region of yeast adenylyl cyclase-associated protein CAP. Association of elongation factor 1 alpha and ribosomal protein L3 with the proline-rich region of yeast adenylyl cyclase-associated protein CAP. Biochem. Biophys. Res. Commun. 232 (503-507) 1997 Yanagihara C., Shinkai M., Kariya K., Yamawaki-Kataoka Y., Hu CD., Masuda T., Kataoka T. kataoka@icluna.kobe-u.ac.jp 22-Jan-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yanagihara C., Shinkai M., Kariya K., Yamawaki-Kataoka Y., Hu CD., Masuda T., Kataoka T. kataoka@icluna.kobe-u.ac.jp Accepted 2007-Not a month!-10 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Biochem. Biophys. Res. Commun. 232 (503-507) 1997 orchard Association of elongation factor 1 alpha and ribosomal protein L3 with the proline-rich region of yeast adenylyl cyclase-associated protein CAP. Association of elongation factor 1 alpha and ribosomal protein L3 with the proline-rich region of yeast adenylyl cyclase-associated protein CAP. Biochem. Biophys. Res. Commun. 232 (503-507) 1997 Yanagihara C., Shinkai M., Kariya K., Yamawaki-Kataoka Y., Hu CD., Masuda T., Kataoka T. kataoka@icluna.kobe-u.ac.jp 22-Jan-2008: Contacted by JYOTI. orchard in vitro In vitro pull down pull down edman degradation edman degradation Yanagihara C., Shinkai M., Kariya K., Yamawaki-Kataoka Y., Hu CD., Masuda T., Kataoka T. kataoka@icluna.kobe-u.ac.jp Accepted 2007-Not a month!-10 by ORCHARD. Biochem. Biophys. Res. Commun. 232 (503-507) 1997 orchard ef1a_yeast Elongation factor 1-alpha TEF1 YPR080W P9513.7 TEF2 YBR118W YBR0913 Translation elongation factor 1A Eukaryotic elongation factor 1A protein protein yeast Saccharomyces cerevisiae Baker's yeast MGKEKSHINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKAGVVKGKTLLEAIDAIEQPSRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPAGVTTEVKSVEMHHEQLEQGVPGDNVGFNVKNVSVKEIRRGNVCGDAKNDPPKGCASFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDHPKFLKSGDAALVKFVPSKPMCVEAFSEYPPLGRFAVRDMRQTVAVGVIKSVDKTEKAAKVTKAAQKAAKK 411C66D830716576 411C66D830716576 cap_yeast Adenylyl cyclase-associated protein SRV2 CAP1 YNL138W N1210 N1838 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPDSKYTMQGYNLVKLLKRLEEATARLEDVTIYQEGYIQNKLEASKNNKPSDSGADANTTNEPSAENAPEVEQDPKCITAFQSYIGENIDPLVELSGKIDTVVLDALQLLKGGFQSQLTFLRAAVRSRKPDYSSQTFADSLRPINENIIKLGQLKESNRQSKYFAYLSALSEGAPLFSWVAVDTPVSMVTDFKDAAQFWTNRILKEYRESDPNAVEWVKKFLASFDNLKAYIKEYHTTGVSWKKDGMDFADAMAQSTKNTGATSSPSPASATAAPAPPPPPPAPPASVFEISNDTPATSSDANKGGIGAVFAELNQGENITKGLKKVDKSQQTHKNPELRQSSTVSSTGSKSGPPPRPKKPSTLKTKRPPRKELVGNKWFIENYENETESLVIDANKDESIFIGKCSQVLVQIKGKVNAISLSETESCSVVLDSSISGMDVIKSNKFGIQVNHSLPQISIDKSDGGNIYLSKESLNTEIYTSCSTAINVNLPIGEDDDYVEFPIPEQMKHSFADGKFKSAVFEHAG 0EB4D41205E2D464 0EB4D41205E2D464 rl3_yeast 60S ribosomal protein L3 MAK8 RPL3 TCM1 YOR063W YOR29-14 YL1 RP1 Maintenance of killer protein 8 Trichodermin resistance protein Large ribosomal subunit protein uL3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL 986769A218E9698A cap-ef1 3 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Fig. 2A cap-ef1-1 1 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 2B In vivo association of EF1a and rL3 with CAP cap-lr3 1 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 2C In vivo association of EF1a and rL3 with CAP cap-lr3-1 2 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey physical association physical association Fig. 3C In vivo association of EF1a and rL3 with CAP cap-ef1-2 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3B In vivo association of EF1a and rL3 with CAP