IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of mouse adenovirus type 1 early region 1A protein with cellular proteins pRb and p107. Interaction of mouse adenovirus type 1 early region 1A protein with cellular proteins pRb and p107. Virology (0042-6822) 1996 Smith K., Ying B., Ball AO., Beard CW., Spindler KR. Cancer - Interactions investigated in the context of cancer spindler@uga.cc.uga.edu in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Smith K., Ying B., Ball AO., Beard CW., Spindler KR. Cancer - Interactions investigated in the context of cancer spindler@uga.cc.uga.edu Accepted 2007-APR-22 by DAVET. Virology (0042-6822) 1996 rb_mouse Retinoblastoma-associated protein Rb1 Rb-1 pRb pp105 p110-RB1 protein protein mouse Mus musculus Mouse MPPKAPRRAAAAEPPPPPPPPPREDDPAQDSGPEELPLARLEFEEIEEPEFIALCQKLKVPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEINSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYKTAAIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFINSLGIVSSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKNNPDEEANVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHIFKEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQGNHTAADMYLSPLRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTSTRTRMQKQRMNESKDVSNKEEK DIP protein P13405 original sequence version: 115 DIP protein P13405 original sequence version: 114 DIP protein P13405 original sequence version: 110 AE81D35A07ADB493 e1a_adem1 Early E1A 21 kDa protein protein protein adem1 Murine adenovirus A serotype 1 (MAdV-1) Murine adenovirus 1 MSRLLRLSLSSRVWLAAQEATRNVSEDPVVCRTPWDGSPTCTAVRVVRAEVLADGTMDLDIVFPEAAVQAVFSRTPWQDSTTATSAEEPSASTDSISSDPLPISCVESFEDMDLRCYEQLSPSPESIETIEVFPPCSTCGGHEVNGFCSLCYLRGLTDLLPQADDAGEAEVPDESAKDLCFMDLLTWAMEDKTECSRHDE 5B63D6E6272639E5 rbl1_mouse Retinoblastoma-like protein 1 Rbl1 pRb1 107 kDa retinoblastoma-associated protein protein protein mouse Mus musculus Mouse MFEDEPHAEGAAAVAAAREALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLACSLYVACRKSIIPTVGKGVMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKFEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRRDLLNPSFKGLPSDFHAPDFKAAEEPPCIIAVLCDLHDGLLVEAKGIKEHYFKPYISKLFDKKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTADTPFGKLTSQASVECNLQQHFEKKRSFAPSTPLTGRRYLQEKEAVTTPVASATQSVSRLQSIVAGLKSAPSEQLLNIFESCMRNPMGNIIKIVKGIGETFCQHYTQSTDKQPGSHIDFAVNRLKLAEILYYKILETIMVQETRRLHGMDMSVLLEQDIFHKSLMACCLEIVLFAYSSPRTFPWIIEVLDLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILESLAWTNNSALWEALHASANRVPSCEEVIFPNNFEIGNGGNVQGHLPMMPMSPIIHPRVKEVRTDSGSLRQDMQPLSPISVHERYSSPAAGSAKRRLFGDDPPKDTLMDKIMAEGTKLKIAPSSVTAESLSISPGQALLTMATTTVTGTTGRKVTVPLHGIANDAGEITLVPISMNPTQESTAESPVSLTAQSLIGTSPKQTHLTKAQDAHLTGVSKPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPGGVVVYNGDCEMTDGDIEDATKTPNCSSEPVKEERGDLIKFYNTVYVGRVKSFALKYDLSNQDHIMDAPPLSPFPHIKQQPGSPRRISQQHSLYVSPHKNGAGLTPRSALLYKFNGSPSKSLKDINNMIRQGEQKTKKRVIAISGDADSPAKRLCQENDDVLLKRLQDVVSERANH 85BEA8EC064EC06E e1a-rb1 1 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse-3t6 Mus musculus - Swiss albino mouse embryonic fibroblasts 3t6 Swiss albino mouse embryonic fibroblasts Swiss albino mouse fibroblasts established from disaggregated Swiss albino mouse embryos in 1963; cells were described to secrete collagen and hyaluronic acid confirmed as mouse with IEF of AST, G6PD, MDH, NP 2 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 4 Both dlE105 (CR1D)- and dlE106 (CR3D)-infected showed coimmunoprecipitation of pRb and E1A, although to lower levels, 4% and 55% of wild-type, respectively. The low proportion of pRb coimmunoprecipitated from dlE105-infected cells compared to wild-type-infected cells may reflect a cooperative role for E1A CR1 in pRb association with E1A. expressed from dlE102 (CR2D) and dlE106 (CR3D) mi- pRb coimmunoprecipitation did not occur with mock-,dlE102 (CR2D)-, The deleted region aa 112-128 of E1A contains the conserved region 2 (CR2). Conserved region 1 (CR1) may also be involved in binding as coimmunoprecipitation was reduced to 4% of the wild-type when it was deleted. e1a-rbl1 1 3 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain mouse-3t6 Mus musculus - Swiss albino mouse embryonic fibroblasts 3t6 Swiss albino mouse embryonic fibroblasts Swiss albino mouse fibroblasts established from disaggregated Swiss albino mouse embryos in 1963; cells were described to secrete collagen and hyaluronic acid confirmed as mouse with IEF of AST, G6PD, MDH, NP 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 5 The deleted region aa 112-128 of E1A contains the conserved region 2 (CR2). Conserved region 1 (CR1) may also be involved in binding as coimmunoprecipitation was reduced to 4% of the wild-type when it was deleted. A reduced amount of p107 was coimmunopre-cipitated with E1A from both dlE105 (CR1D)- and dlE106 (CR3D)-infected cells (6 and 83% of wild-type, respec-tively, the mean of three experiments) compared to wild-type infected cells (Fig. 5, lanes 10, 12 and 18, 20). p107 was not coimmunoprecipitated from mock-, dlE102 (CR2D)-, or pmE109 (TTG)-infected cells