IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Crystal structure of the eukaryotic DNA polymerase processivity factor PCNA. Crystal structure of the eukaryotic DNA polymerase processivity factor PCNA. Cell (0092-8674) 1994 imex curation Krishna TS., Kong XP., Gary S., Burgers PM., Kuriyan J. PCNA purified by ammonium sulphate precipitation and mercurated by treatment with 0.4mM HgCl2. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Krishna TS., Kong XP., Gary S., Burgers PM., Kuriyan J. PCNA purified by ammonium sulphate precipitation and mercurated by treatment with 0.4mM HgCl2. Accepted 2007-APR-5 by DAVET. Cell (0092-8674) 1994 Only protein-protein interactions imex curation pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC 9B56C5851621DDDC pcna-8 1 2 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 2.30A Three PCNA molecules, each containing two topologically identical domains, are tightly associated to form a closed ring. 18.8%