IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. J. Biol. Chem. (0021-9258) 2007 Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it 22-Jan-2008: Contacted by JYOTI. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it Accepted 2007-DEC-21 by JYOTI. 22-Jan-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2007 Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. J. Biol. Chem. (0021-9258) 2007 Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it 22-Jan-2008: Contacted by JYOTI. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it Accepted 2007-DEC-21 by JYOTI. 22-Jan-2008: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2007 Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. Spontaneous assembly of photosynthetic supramolecular complexes as mediated by the intrinsically unstructured protein CP12. J. Biol. Chem. (0021-9258) 2007 Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it 22-Jan-2008: Contacted by JYOTI. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Marri L., Trost P., Trivelli X., Gonnelli L., Pupillo P., Sparla F. trost@alma.unibo.it Accepted 2007-DEC-21 by JYOTI. J. Biol. Chem. (0021-9258) 2007 g3pa1_arath Glyceraldehyde-3-phosphate dehydrogenase GAPA1, chloroplastic GAPA1 GAPA NADP-dependent glyceraldehydephosphate dehydrogenase A subunit 1 MLJ15.4 MLJ15_5 At3g26650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASVTFSVPKGFTEFSGLRSSSASLPFGKKLSSDEFVSIVSFQTSAMGSSGGYRKGVTEAKLKVAINGFGRIGRNFLRCWHGRKDSPLDIIAINDTGGVKQASHLLKYDSTLGIFDADVKPSGETAISVDGKIIQVVSNRNPSLLPWKELGIDIVIEGTGVFVDREGAGKHIEAGAKKVIITAPGKGDIPTYVVGVNADAYSHDEPIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRDSAEKELKGILDVCDEPLVSVDFRCSDFSTTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANNWK FFD7FD662FB222FC cp122_arath Calvin cycle protein CP12-2, chloroplastic CP12-2 CP12 domain-containing protein 2 Chloroplast protein 12-2 T12C14.110 At3g62410 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATIATGLNIATQRVFVTSENRPVCLAGPVHLNNSWNLGSRTTNRMMKLQPIKAAPEGGISDVVEKSIKEAQETCAGDPVSGECVAAWDEVEELSAAASHARDKKKADGSDPLEEYCKDNPETNECRTYDN 6EFE1E1CC039B2EF kppr_arath Phosphoribulokinase, chloroplastic Phosphopentokinase At1g32060 T12O21.4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAVSTIYSTQALNSTHFLTSSSSSKQVFLYRRQPQTNRRFNTLITCAQETIVIGLAADSGCGKSTFMRRLTSVFGGAAKPPKGGNPDSNTLISDTTTVICLDDYHSLDRYGRKEQKVTALDPRANDFDLMYEQVKALKNGIAVEKPIYNHVTGLLDPPELIQPPKILVIEGLHPMFDERVRDLLDFSIYLDISNEVKFAWKIQRDMAERGHSLESIKASIEARKPDFDAFIDPQKQYADAVIEVLPTTLIPDDNEGKVLRVRLIMKEGVKYFSPVYLFDEGSTISWIPCGRKLTCSYPGIKFNYEPDSYFDHEVSVLEMDGQFDRLDELIYVESHLSNLSTKFYGEVTQQMLKHADFPGSNNGTGLFQTIVGLKIRDLYEQLIANKATARAEAKA 4660A92EF7E39BC6 cp12-gapdh 3 5 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Table 1 Since MALS data are independent of protein conformational effects, they do suggest that two CP12-2 molecules can bind to one A4-GAPDH tetramer giving rise to an (A4-GAPDH)-(CP12-2)2 binary complex (calculated Mr = 166 kDa, Table 1). cp12-gapdh-1 1 5 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 3 different affinities between binding sites. Binding of two CP12-2 molecules to each A4-GAPDH tetramer K0 = 0.18 +/- 0.02 micro moles Gibbs free energy of interaction -9.4 kcal per mole Interaction was found to be exoergonic overall. cp12-gapdh--prk 1 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 4 Thermodynamic parameters of the interaction between PRK and (A4-GAPDH)-(CP12-2)2 were also determined by ITC K0 = 0.17 +/- 0.09 micro moles Gibbs free energy of interaction -9.3 kcal per mole Thermodynamic parameters indicated that ternary complex assembly was largely exothermic. cp12-gapdh-2 2 5 unspecified role unspecified role neutral component neutral component Q9LZP9:p.Cys126Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:14:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys126ser' Tue Jun 30 19:31:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys126Ser' ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role neutral component neutral component ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction 5 In vitro reconstitution of (A4-GAPDH)/(CP12-2) binary complexes with wild type and site-specific mutants of CP12-2.