IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana. The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana. PLoS Genet. (1553-7390) 2007 imex curation Vignard J., Siwiec T., Chelysheva L., Vrielynck N., Gonord F., Armstrong SJ., Schlogelhofer P., Mercier R. peter.schloegelhofer@univie.ac.at 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Vignard J., Siwiec T., Chelysheva L., Vrielynck N., Gonord F., Armstrong SJ., Schlogelhofer P., Mercier R. peter.schloegelhofer@univie.ac.at Accepted 2007-Not a month!-13 by CDEROW. PLoS Genet. (1553-7390) 2007 Only protein-protein interactions imex curation The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana. The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana. PLoS Genet. (1553-7390) 2007 imex curation Vignard J., Siwiec T., Chelysheva L., Vrielynck N., Gonord F., Armstrong SJ., Schlogelhofer P., Mercier R. peter.schloegelhofer@univie.ac.at 22-Jan-2008: Contacted by JYOTI. Only protein-protein interactions arath-pollen Arabidopsis thaliana pollen Pollen fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Vignard J., Siwiec T., Chelysheva L., Vrielynck N., Gonord F., Armstrong SJ., Schlogelhofer P., Mercier R. Meiocyte spreads were made from arabidopsis pollen and used in immunostaining studies reported here. Identification for ASY1 was made from reference PMID 12186950 . peter.schloegelhofer@univie.ac.at Accepted 2007-Not a month!-13 by CDEROW. 22-Jan-2008: Contacted by JYOTI. PLoS Genet. (1553-7390) 2007 Only protein-protein interactions imex curation rad51_arath DNA repair protein RAD51 homolog 1 RAD51 Rad51-like protein 1 At5g20850 F22D1.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTMEQRRNQNAVQQQDDEETQHGPFPVEQLQAAGIASVDVKKLRDAGLCTVEGVAYTPRKDLLQIKGISDAKVDKIVEAASKLVPLGFTSASQLHAQRQEIIQITSGSRELDKVLEGGIETGSITELYGEFRSGKTQLCHTLCVTCQLPMDQGGGEGKAMYIDAEGTFRPQRLLQIADRFGLNGADVLENVAYARAYNTDHQSRLLLEAASMMIETRFALLIVDSATALYRTDFSGRGELSARQMHLAKFLRSLQKLADEFGVAVVITNQVVAQVDGSALFAGPQFKPIGGNIMAHATTTRLALRKGRAEERICKVISSPCLPEAEARFQISTEGVTDCKD DIP protein P94102 original sequence version: 92 08067F8D85A2E77D mnd1_arath Meiotic nuclear division protein 1 homolog MND1 Meiotic nuclear division 1-like protein F19B15.200 At4g29170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVAKDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERTEALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCSNNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSSSHEADTAKQLVQDEA 131BB5146D8C91ED asy1_arath Meiosis-specific protein ASY1 At1g67370/At1g67380 ASY1 Protein ASYNAPTIC 1 F1N21.19/F1N21.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVMAQKLKEAEITEQDSLLLTRNLLRIAIFNISYIRGLFPEKYFNDKSVPALDMKIKKLMPMDAESRRLIDWMEKGVYDALQRKYLKTLMFSICETVDGPMIEEYSFSFSYSDSDSQDVMMNINRTGNKKNGGIFNSTADITPNQMRSSACKMVRTLVQLMRTLDKMPDERTIVMKLLYYDDVTPPDYEPPFFRGCTEDEAQYVWTKNPLRMEIGNVNSKHLVLTLKVKSVLDPCEDENDDMQDDGKSIGPDSVHDDQPSDSDSEISQTQENQFIVAPVEKQDDDDGEVDEDDNTQDPAENEQQLARVKDWINSRHLDTLELTDILANFPDISIVLSEEIMDQLVTEGVLSKTGKDMYIKKRDKTPESEFTFVKEEADGQISPGKSVAPEDYLYMKALYHSLPMKYVTITKLHNMLDGEANQTAVRKLMDRMTQEGYVEASSNRRLGKRVIHSSLTEKKLNEVRKVLATDDMDVDVTETINKTNGPDAKVTADVSTCGGIHSIGSDFTRTKGRSGGMQQNGSVLSEQTISKAGNTPISNKAQPAASRESFAVHGGAVKEAETVNCSQASQDRRGRKTSMVREPILQYSKRQKSQAN 3D4E8D1B48D2E6D2 ahp2_arath Histidine-containing phosphotransfer protein 2 AHP2 ATHP1 At3g29350 MUO10.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN 9A8FA1184F0E4462 dmc1_arath Meiotic recombination protein DMC1 homolog DMC1 LIM15 F5N5.6 At3g22880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMASLKAEETSQMQLVEREENDEDEDLFEMIDKLIAQGINAGDVKKLQEAGIHTCNGLMMHTKKNLTGIKGLSEAKVDKICEAAEKIVNFGYMTGSDALIKRKSVVKITTGCQALDDLLGGGIETSAITEAFGEFRSGKTQLAHTLCVTTQLPTNMKGGNGKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRILIVDSIIALFRVDFTGRGELADRQQKLAQMLSRLIKIAEEFNVAVYMTNQVIADPGGGMFISDPKKPAGGHVLAHAATIRLLFRKGKGDTRVCKVYDAPNLAEAEASFQITQGGIADAKD E0A97D320A41387D ahp2-mnd1 1 4 unspecified role unspecified role prey prey n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9 We demonstrated binding of AtMND1 and AHP2 mnd1-ahp2 1 4 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9 We demonstrated binding of AtMND1 and AHP2 mnd1-mnd1 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role bait bait n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 9 AtMND1 also interacted with itself, but the coimmunoprecipitation of an AtMND1�AtMND1 complex was only possible with one of the two epitope tags used ahp2-dmc1 1 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9 Both AtMND1 and AHP2 interacted with AtDMC1 (Figure 9, lanes 3 and 4). dmc1-mnd1 1 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 9 We demonstrated binding of AtMND1 and AHP2 dmc1-ahp2 1 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9 Both AtMND1 and AHP2 interacted with AtDMC1 (Figure 9, lanes 3 and 4). mnd1-dmc1 1 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 9 We demonstrated binding of AtMND1 and AHP2 ahp2-rad51 1 3 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 9 In addition, both AHP2 and AtMND1 interacted with AtRAD51 (Figure 9, lanes 5 and 6). While the AHP2-AtRAD51 interaction was detected with only one of the two epitope tags used (Figure 9, lane 5), the interaction of AtMND1 with AtRAD51 was detected with both of the two epitope tags mnd1-rad51 1 4 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 3 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 9 Interactions of AtMND1 with itself have also been reported in a yeast two-hybrid assay (unpublished data). Both AtMND1 and AHP2 interacted with AtDMC1 (Figure 9, lanes 3 and 4). In addition, both AHP2 and AtMND1 interacted with AtRAD51 (Figure 9, lanes 5 and 6). While the AHP2-AtRAD51 interaction was detected with only one of the two epitope tags used (Figure 9, lane 5), the interaction of AtMND1 with AtRAD51 was detected with bothof the two epitope tags rad51-mnd1 1 3 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role prey prey n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 9 Interactions of AtMND1 with itself have also been reported in a yeast two-hybrid assay (unpublished data). Both AtMND1 and AHP2 interacted with AtDMC1 (Figure 9, lanes 3 and 4). In addition, both AHP2 and AtMND1 interacted with AtRAD51 (Figure 9, lanes 5 and 6). While the AHP2-AtRAD51 interaction was detected with only one of the two epitope tags used (Figure 9, lane 5), the interaction of AtMND1 with AtRAD51 was detected with bothof the two epitope tags asy1-mnd1 2 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 3, 4 As meiosis progressed and the ASY1 signal extended all along the axial element, AtMND1 was detected along the entire length of the chromosome, in both unsynapsed and synapsed chromosome regions The authors state that "As meiosis progressed and the ASY1 signal extended all along the axial element, AtMND1 was detected along the entire length of the chromosome, in both unsynapsed and synapsed chromosome regions. The MND1 labeling was thicker than the one for ASY1, for which the signal was detected exclusively along the axis of the chromosomes. Thus, in clear contrast to ASY1, AtMND1 was localized to both chromosome axes and loop regions. Regions of lower and higher intensity of AtMND1 signal were detected, the higher-intensity regions resembling foci". asy1-dmc1 2 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 8 An antibody directed against a synthetic peptide specific for the AtDMC1 protein [46] was used in immunolocalization experiments, together with an antibody against ASY1 [35]. We analyzed the number of AtDMC1 foci on wild-type chromosomes during meiotic progression and obtained results similar to those reported by [46], with the number of AtDMC1 foci maximal during zygotene AtDMC1 foci are localized on the chromosome axes, as revealed by the ASY1 signal.The number of AtDMC1 foci was maximal during zygotene.