IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia confocal microscopy confocal microscopy immunostaining immunostaining Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions human-hvts_sm1 Homo sapiens immortalized vascular smooth muscle cells (HVTs-SM1) hvts_sm1 Immortalized human vascular smooth muscle cells (HVTs-SM1) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions human-vsmc Homo sapiens aortic vascular smooth muscle cells vsmc Human aortic vascular smooth muscle cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions human-hvts_sm1 Homo sapiens immortalized vascular smooth muscle cells (HVTs-SM1) hvts_sm1 Immortalized human vascular smooth muscle cells (HVTs-SM1) confocal microscopy confocal microscopy immunostaining immunostaining Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression. Oncogene (0950-9232) 2007 imex curation Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. davet Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Achour M., Jacq X., Ronde P., Alhosin M., Charlot C., Chataigneau T., Jeanblanc M., Macaluso M., Giordano A., Hughes AD., Schini-Kerth VB., Bronner C. Cancer - Interactions investigated in the context of cancer Christian.Bronner@pharma.u-strasbg.fr Accepted 2007-NOV-31 by DAVET. 22-Jan-2008: Contacted by JYOTI. A human placenta cDNA library was used. Oncogene (0950-9232) 2007 davet Only protein-protein interactions imex curation dnmt1_human DNA (cytosine-5)-methyltransferase 1 CXXC9 MCMT DNA methyltransferase HsaI CXXC-type zinc finger protein 9 DNMT1 AIM DNMT protein protein human Homo sapiens Human MPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNREVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESERAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEEERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKKHRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD DIP protein P26358 original sequence version: 171 DIP protein P26358-1 original sequence version: 121 DIP protein P26358 original sequence version: 121 DIP protein P26358-1 original sequence version: 128 DIP protein P26358 original sequence version: 128 1E833192D22AFA5B hdac1_human Histone deacetylase 1 HDAC1 RPD3L1 protein protein human Homo sapiens Human MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA DIP protein Q13547 original sequence version: 106 DIP protein Q13547 original sequence version: 173 DIP protein Q13547 original sequence version: 100 DIP protein Q13547 original sequence version: 166 DIP protein Q13547 original sequence version: 153 DIP protein Q13547 original sequence version: 164 DIP protein Q13547 original sequence version: 175 DIP protein Q13547 original sequence version: 191 DIP protein Q13547 original sequence version: 185 DIP protein Q13547 original sequence version: 165 DIP protein Q13547 original sequence version: 162 DIP protein Q13547 original sequence version: 189 DIP protein Q13547 original sequence version: 158 DIP protein Q13547 original sequence version: 134 DIP protein Q13547 original sequence version: 124 4D35B7C1ED7838D6 uhrf1_human E3 ubiquitin-protein ligase UHRF1 UHRF1 ICBP90 NP95 RNF106 Ubiquitin-like PHD and RING finger domain-containing protein 1 Ubiquitin-like-containing PHD and RING finger domains protein 1 Inverted CCAAT box-binding protein of 90 kDa Transcription factor ICBP90 Nuclear zinc finger protein Np95 Nuclear protein 95 RING finger protein 106 RING-type E3 ubiquitin transferase UHRF1 protein protein human Homo sapiens Human MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQTVLNQLFPGYGNGR E65B15657525C89F uhrf1-dnmt1 3 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait region SRA domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association we screened a human placenta library using a fragment encompassing the SRA domain of ICBP90 (that is, amino acids 356-635; Figure 1 and Materials and methods). We identified 154 clones by histidine nutritional selection and b-galactosidase (b-gal) activity. The inserts from the isolated clones were sequenced, leading to the identification of 11 overlapping clones that encode a region of a protein named DNMT1 for DNA methyltransferase 1. The overlapping sequences of the yeast two-hybrid DNMT1 preys encompass a peptide that extends between residues 401-615 of human DNMT1. dnmt1-uhfr1 7 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobb Escherichia coli (strain B / BL21) 10 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association 2 these results suggest that DNMT1 is a likely candidate to fulfil the requirements of an ICBP90 partner. uhfr1-dnmt1 1 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association 3 A, S1 B Immunoprecipitation with the anti-ICBP90 mAb (Figure 3a) or anti-HDAC1 or with anti-DNMT1 (Figure 3b) showed bands for DNMT1, ICBP90 and HDAC1 in all experimental conditions, with the highest amount found in mimosine-treated cells Cells blocked in G1 by mimosine treatment showed higher levels of these interactions as compared to proliferating cells and confluent cells. Confluent cells showed the lowest levels of these interactions. Mimosine - These interactions were enhanced by mimosine-treatment, which blocks cells in late G1 and prevents entry into S phase. hdac1-dnmt1 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association 3 B Immunoprecipitation with the anti-ICBP90 mAb (Figure 3a) or anti-HDAC1 or with anti-DNMT1 (Figure 3b) showed bands for DNMT1, ICBP90 and HDAC1 in all experimental conditions, with the highest amount found in mimosine-treated cells dnmt1-hdac1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 3 B, S1 C Immunoprecipitation with the anti-ICBP90 mAb (Figure 3a) or anti-HDAC1 or with anti-DNMT1 (Figure 3b) showed bands for DNMT1, ICBP90 and HDAC1 in all experimental conditions, with the highest amount found in mimosine-treated cells uhfr1-hdac1 4 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 4 A DNMT1 and HDAC1 were present in immunoprecipitates obtained with anti-ICBP90 mAb, with higher amounts found in mimosine-treated cells Mimosine - These interactions are enhanced by treatment of cells with mimosine, which blocks cells in late G1 phase and prevents entry into S phase. These interactions are enhanced in cells blocked in G1 phase as compared to proliferating cells. hdac1-dnmt1-2 4 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association 4 B ICBP90, DNMT1 and HDAC1 were found co-immunoprecipitated by anti-HDAC1 and anti-DNMT1 Abs dnmt1-hdac1-3 4 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 4 B ICBP90, DNMT1 and HDAC1 were found co-immunoprecipitated by anti-HDAC1 and anti-DNMT1 Abs uhfr1-dnmt1-1 5 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association S1 B when using the anti-ICBP90 mAb as the precipitating antibody, DNMT1 and HDAC1 were found to be co-immunoprecipitated in proliferating VSMCs but not in confluent cells as a consequence of the lack of ICBP90 expression at confluency These interactions occured in proliferating cells but not in confluent cells, due to lack of expression of ICBP90 at confluency. dnmt1-hdac1-4 5 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey association association S1 C These interactions occured in proliferating cells but not in confluent cells, due to lack of expression of ICBP90 at confluency. When using the anti-DNMT1 mAb, ICBP90 and HDAC1 were co-immunoprecipitated in proliferating VSMCs dnmt1-uhfr1-1 2 8 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 5 C The merged picture (Figure 5c) showed that ICBP90 and DNMT1 were in general colocalized in discrete regions in the nucleus, and that the interaction between ICBP90 and DNMT1 is a highly frequent event. Colocalization occurred in the nucleus. dnmt1-uhfr1-2 6 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 C Colocalization occurred in the nucleus. In HVTs-SM1 cells, ICBP90 (Figure 6a) and DNMT1 (Figure 6b) were also co-localized in the entire nucleoplasm