IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Yeast two-hybrid analysis of the origin recognition complex of Saccharomyces cerevisiae: interaction between subunits and identification of binding proteins. Yeast two-hybrid analysis of the origin recognition complex of Saccharomyces cerevisiae: interaction between subunits and identification of binding proteins. FEMS Yeast Res. (1567-1356) 2007 imex curation Matsuda K., Makise M., Sueyasu Y., Takehara M., Asano T., Mizushima T. Beta-galactoside assays were carried out. mizu@gpo.kumamoto-u.ac.jp 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Matsuda K., Makise M., Sueyasu Y., Takehara M., Asano T., Mizushima T. Beta-galactoside assays were carried out. mizu@gpo.kumamoto-u.ac.jp Accepted 2007-OCT-25 by JYOTI. FEMS Yeast Res. (1567-1356) 2007 Only protein-protein interactions imex curation Yeast two-hybrid analysis of the origin recognition complex of Saccharomyces cerevisiae: interaction between subunits and identification of binding proteins. Yeast two-hybrid analysis of the origin recognition complex of Saccharomyces cerevisiae: interaction between subunits and identification of binding proteins. FEMS Yeast Res. (1567-1356) 2007 imex curation Matsuda K., Makise M., Sueyasu Y., Takehara M., Asano T., Mizushima T. Beta-galactoside assays were carried out. mizu@gpo.kumamoto-u.ac.jp 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Matsuda K., Makise M., Sueyasu Y., Takehara M., Asano T., Mizushima T. Leucine requirement assays were carried out. mizu@gpo.kumamoto-u.ac.jp Accepted 2007-OCT-25 by JYOTI. 12-Oct-2007: Contacted by JYOTI. FEMS Yeast Res. (1567-1356) 2007 Only protein-protein interactions imex curation Yeast two-hybrid analysis of the origin recognition complex of Saccharomyces cerevisiae: interaction between subunits and identification of binding proteins. Yeast two-hybrid analysis of the origin recognition complex of Saccharomyces cerevisiae: interaction between subunits and identification of binding proteins. FEMS Yeast Res. (1567-1356) 2007 imex curation Matsuda K., Makise M., Sueyasu Y., Takehara M., Asano T., Mizushima T. Beta-galactoside assays were carried out. mizu@gpo.kumamoto-u.ac.jp 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast two hybrid array two hybrid array nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Matsuda K., Makise M., Sueyasu Y., Takehara M., Asano T., Mizushima T. mizu@gpo.kumamoto-u.ac.jp Accepted 2007-OCT-25 by JYOTI. 12-Oct-2007: Contacted by JYOTI. A yeast genomic library was used. FEMS Yeast Res. (1567-1356) 2007 Only protein-protein interactions imex curation orc4_yeast Origin recognition complex subunit 4 ORC4 YPR162C P9325.5 Origin recognition complex 56 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MTISEARLSPQVNLLPIKRHSNEEVEETAAILKKRTIDNEKCKDSDPGFGSLQRRLLQQLYGTLPTDEKIIFTYLQDCQQEIDRIIKQSIIQKESHSVILVGPRQSYKTYLLDYELSLLQQSYKEQFITIRLNGFIHSEQTAINGIATQLEQQLQKIHGSEEKIDDTSLETISSGSLTEVFEKILLLLDSTTKTRNEDSGEVDRESITKITVVFIFDEIDTFAGPVRQTLLYNLFDMVEHSRVPVCIFGCTTKLNILEYLEKRVKSRFSQRVIYMPQIQNLDDMVDAVRNLLTVRSEISPWVSQWNETLEKELSDPRSNLNRHIRMNFETFRSLPTLKNSIIPLVATSKNFGSLCTAIKSCSFLDIYNKNQLSNNLTGRLQSLSDLELAILISAARVALRAKDGSFNFNLAYAEYEKMIKAINSRIPTVAPTTNVGTGQSTFSIDNTIKLWLKKDVKNVWENLVQLDFFTEKSAVGLRDNATAAFYASNYQFQGTMIPFDLRSYQMQIILQELRRIIPKSNMYYSWTQL ACF064F2C633F13F ACF064F2C633F13F orc5_yeast Origin recognition complex subunit 5 ORC5 YNL261W N0834 Origin recognition complex 53 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MNVTTPEVAFREYQTNCLASYISADPDITPSNLILQGYSGTGKTYTLKKYFNANPNLHAVWLEPVELVSWKPLLQAIARTVQYKLKTLYPNIPTTDYDPLQVEEPFLLVKTLHNIFVQYESLQEKTCLFLILDGFDSLQDLDAALFNKYIKLNELLPKDSKINIKFIYTMLETSFLQRYSTHCIPTVMFPRYNVDEVSTILVMSRCGELMEDSCLRKRIIEEQITDCTDDQFQNVAANFIHLIVQAFHSYTGNDIFALNDLIDFKWPKYVSRITKENIFEPLALYKSAIKLFLSTDDNLSENGQGESAITTNRDDLENSQTYDLSIISKYLLIASYICSYLEPRYDASIFSRKTRIIQGRAAYGRRKKKEVNPRYLQPSLFAIERLLAIFQAIFPIQGKAESGSLSALREESLMKANIEVFQNLSELHTLKLIATTMNKNIDYLSPKVRWKVNVPWEIIKEISESVHFNISDYFSDIHE 1FE5DE28AFF6B41C 1FE5DE28AFF6B41C orc3_yeast Origin recognition complex subunit 3 ORC3 OAF1 OIF1 YLL004W L1365 Origin recognition complex 62 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDLNQSKKMNVSEFADAQRSHYTVYPSLPQSNKNDKHIPFVKLLSGKESEVNVEKRWELYHQLHSHFHDQVDHIIDNIEADLKAEISDLLYSETTQKRRCFNTIFLLGSDSTTKIELKDESSRYNVLIELTPKESPNVRMMLRRSMYKLYSAADAEEHPTIKYEDINDEDGDFTEQNNDVSYDLSLVENFKRLFGKDLAMVFNFKDVDSINFNTLDNFIILLKSAFKYDHVKISLIFNINTNLSNIEKNLRQSTIRLLKRNYHKLDVSSNKGFKYGNQIFQSFLDTVDGKLNLSDRFVEFILSKMANNTNHNLQLLTKMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFFVEGLIKQHAPADEILSLLTNKNRGLEEFFVEFLVRENPINGHAKFVARFLEEELNITNFNLIELYHNLLIGKLDSYLDRWSACKEYKDRLHFEPIDTIFQELFTLDNRSGLLTQSIFPSYKSNIEDNLLSWEQVLPSLDKENYDTLSGDLDKIMAPVLGQLFKLYREANMTINIYDFYIAFRETLPKEEILNFIRKDPSNTKLLELAETPDAFDKVALILFMQAIFAFENMGLIKFQSTKSYDLVEKCVWRGI 3FAAEE3F645D3F9C 3FAAEE3F645D3F9C sir4_yeast Regulatory protein SIR4 STE9 SIR4 ASD1 UTH2 YDR227W YD9934.12 Silent information regulator 4 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPNDNKTPNRSSTPKFTKKPVTPNDKIPEREEKSNEVKTPKIPLFTFAKSKNYSRPSTAIHTSPHQPSDVKPTSHKQLQQPKSSPLKKNNYNSFPHSNLEKISNSKLLSLLRSKTSAGRIESNNPSHDASRSLASFEQTAFSRHAQQQTSTFNSKPVRTIVPISTSQTNNSFLSGVKSLLSEEKIRDYSKEILGINLANEQPVLEKPLKKGSADIGASVISLTKDKSIRKDTVEEKKEEKLNIGKNFAHSDSLSVPKVSAGDSGISPEESKARSPGIAKPNAIQTEVYGINEESTNERLEINQEKPVKLDENSANSTVASALDTNGTSATTETLTSKKIVPSPKKVAIDQDKITLHDEKTLAPSKHQPITSEQKMKEDADLKRMEILKSPHLSKSPADRPQGRRNSRNFSTRDEETTKLAFLVEYEGQENNYNSTSRSTEKKNDMNTSAKNKNGENKKIGKRPPEIMSTEAHVNKVTEETTKQIQSVRIDGRKVLQKVQGESHIDSRNNTLNVTPSKRPQLGEIPNPMKKHKPNEGRTPNISNGTINIQKKLEPKEIVRDILHTKESSNEAKKTIQNPLNKSQNTALPSTHKVTQKKDIKIGTNDLFQVESAPKISSEIDRENVKSKDEPVSKAVESKSLLNLFSNVLKAPFIKSESKPFSSDALSKEKANFLETIASTEKPENKTDKVSLSQPVSASKHEYSDNFPVSLSQPSKKSFANHTEDEQIEKKKICRGRMNTIITHPGKMELVYVSDSDDSSSDNDSLTDLESLSSGESNEIKVTNDLDTSAEKDQIQAGKWFDPVLDWRKSDRELTKNILWRIADKTTYDKETITDLIEQGIPKHSYLSGNPLTSVTNDICSVENYETSSAFFYQQVHKKDRLQYLPLYAVSTFENTNNTEKNDVTNKNINIGKHSQEQNSSSAKPSQIPTVSSPLGFEETKLSTTPTKSNRRVSHSDTNSSKPKNTKENLSKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFANNLKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKPDAKKARFWSFMKTQRFVSNMGFDIQKSCEPVSISTSVKPHVVEPEHMADAKIMPKDILQITKKPLMVKNVKPSSPPDVKSLVQLSTMETKTLPEKKQFDSIFNSNKAKIIPGNGKHASENISLSFSRPASYGYFSVGKRVPIVEDRRVKQLDDITDSNTTEILTSVDVLGTHSQTGTQQSNMYTSTQKTELEIDNKDSVTECSKDMKEDGLSFVDIVLSKAASALDEKEKQLAVANEIIRSLSDEVMRNEIRITSLQGDLTFTKKCLENARSQISEKDAKINKLMEKDFQVNKEIKPY 9C698765964F094E 9C698765964F094E orc1_yeast Origin recognition complex subunit 1 ORC1 YML065W Origin recognition complex 120 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVANVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVEPREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNEDGNEDESSDYESPSDIDVSEDMDSGEISADELEEEEDEEEDEDEEEKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLLISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFYGNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANFQDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKELLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMESLEFYFKRVPKNKKKTIVVLLDELDAMVTKSQDIMYNFFNWTTYENAKLIVIAVANTMDLPERQLGNKITSRIGFTRIMFTGYTHEELKNIIDLRLKGLNDSFFYVDTKTGNAILIDAAGNDTTVKQTLPEDVRKVRLRMSADAIEIASRKVASVSGDARRALKVCKRAAEIAEKHYMAKHGYGYDGKTVIEDENEEQIYDDEDKDLIESNKAKDDNDDDDDNDGVQTVHITHVMKALNETLNSHVITFMTRLSFTAKLFIYALLNLMKKNGSQEQELGDIVDEIKLLIEVNGSNKFVMEIAKTLFQQGSDNISEQLRIISWDFVLNQLLDAGILFKQTMKNDRICCVKLNISVEEAKRAMNEDETLRNL BDAA9D3E40B4B76A BDAA9D3E40B4B76A mad1_yeast Spindle assembly checkpoint component MAD1 MAD1 Mitotic arrest deficient protein 1 YGL086W protein protein yeast Saccharomyces cerevisiae Baker's yeast MDVRAALQCFFSALSGRFTGKKLGLEIYSIQYKMSNSGGSSPFLESPGGSPDVGSTNGQSNRQIQALQFKLNTLQNEYEIEKLQLQKQTNILEKKYKATIDELEKALNDTKYLYESNDKLEQELKSLKERSANSMNDKDKCIEELRTTLQNKDLEMETLRQQYDSKLSKVTNQCDHFKLEAESSHSLLMKYEKEIKRQSVDIKDLQHQVMEKDDELSSVKASKMINSHPNYSTEEFNELTEMNKMIQDQVQYTKELELANMQQANELKKLKQSQDTSTFWKLENEKLQNKLSQLHVLESQYENLQLENIDLKSKLTKWEIYNDSDDDDDNNVNNNDNNNNNKNDNNNDNNNDTSNNNNINNNNRTKNNIRNNPEEIIRDWKLTKKECLILTDMNDKLRLDNNNLKLLNDEMALERNQILDLNKNYENNIVNLKRLNHELEQQKSLSFEECRLLREQLDGLYSAQNNALLEVENSETHASNKNVNEDMNNLIDTYKNKTEDLTNELKKLNDQLLSNSNDVETQRKKRKLTSDQIGLNYSQRLNELQLENVSVSRELSKAQTTIQLLQEKLEKLTKLKEKKIRILQLRDGPFIKDQFIKKNKLLLLEKENADLLNELKKNNPAVETVPISVYDSLNFELKQFEQEVFKSNKRFSRLKQVFNNKSLEFIDVVNSLLGFKLEFQQDSRVKIFSCFKPEKYLIADLNENTLKSNLDADIEGWDDLMNLWVEDRGQLPCFLATITLRLWEQRQAK 312DDE1BE241610D swi6_yeast Regulatory protein SWI6 SWI6 YLR182W L9470.8 Cell-cycle box factor subunit SWI6 Trans-acting activator of HO endonuclease gene MBF subunit P90 protein protein yeast Saccharomyces cerevisiae Baker's yeast MALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETNPDSFPTDEERNKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQDAFEFEEPETDQDEEDPSHSKLPENKTKSENSKDNISSKRINNLQDMSLDSDAHRELGSPLKKLKIDTSVIDAESDSTPNTARGKPNDDINKGPSGDNENNGTDDNDRTAGPIITFTHDLTSDFLSSPLKIMKALPSPVVNDNEQKMKLEAFLQRLLFPEIQEMPTSLNNDSSNRNSEGGSSNQQQQHVSFDSLLQEVNDAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVKSVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIVKKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQDSNGDTCLNIAARLGNISIVDALLDYGADPFIANKSGLRPVDFGAGTSKLQNTNGGDENSKMVSKGDYDGQKNGKAKKIRSQLLKNPPETTSLINDVQNLLNSISKDYENETVQYNEKLEKLHKELNEQREELANSREQLANVKQLKDEYSLMQEQLTNLKAGIEEEEESFREESKKLGIIADESSGIDWDSSEYDADEPFKVEFLSDFLEDKLQKNYEGDISKLLEAESKEQIMEQIRNQLPAEKIQSMLPPTVLLKARINAYKRNDKHLTNVLDTISTKQSELENKFRRVLSLCLKIDENKVDNMLDGLLQAISSEDPQDIDTDEMQDFLKKHAS 9B317FCACEEC493C 9B317FCACEEC493C mpip_yeast M-phase inducer phosphatase MIH1 YMR036C YM9532.01C YM9973.10C Mitosis initiation protein MIH1 Mitotic inducer homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MNNIFHGTEDECANEDVLSFQKISLKSPFGKKKNIFRNVQTFFKSKSKHSNVDDDLINKENLAFDKSPLLTNHRSKEIDGPSPNIKQLGHRDELDENENENDDIVLSMHFASQTLQSPTRNSSRRSLTNNRDNDLLSRIKYPGSPQRSSSFSRSRSLSRKPSMNSSSNSSRRVQRQDGKIPRSSRKSSQKFSNITQNTLNFTSASSSPLAPNSVGVKCFESCLAKTQIPYYYDDRNSNDFFPRISPETLKNILQNNMCESFYNSCRIIDCRFEYEYTGGHIINSVNIHSRDELEYEFIHKVLHSDTSNNNTLPTLLIIHCEFSSHRGPSLASHLRNCDRIINQDHYPKLFYPDILILDGGYKAVFDNFPELCYPRQYVGMNSQENLLNCEQEMDKFRRESKRFATKNNSFRKLASPSNPNFFYRDSHQSSTTMASSALSFRFEPPPKLSLNHRRVSSGSSLNSSESTGDENFFPILSKSSMSSNSNLSTSHMLLMDGLDTPSYFSFEDERGNHQQVSGDEEQDGDFTFVGSDREDLPRPARRSLFPSLETEDKK DBD85D02CF48CA6F DBD85D02CF48CA6F msa2_yeast Putative transcriptional activator MSA2 YKR077W MSA2 MBF and SBF-associated protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVYTTPQQQQRFSSTPQSSHTLIFSPIRAPSMQTPSSLDYQSPSIVVSSSSMKVHGRSSSFGKFSLSIGQNGKATILGPINVLPTDTSKMEKPVPKKKPVTSDRVEKTRILSLLKKMRNKSSTVNKKYSKVPLKSTTSLQPAATAPSPLVSNIIKPSPKKLASPRTPNANSNLNLNFTSFQIKTGFTPNLDGILLENFTSPNTTADSQGNSASNIINNNHGSANNTNQFLFNLPLQSSPRQFRSPARLIDPLPISDWNTSLLMSPPRTTNFESANNHFNSNFAQASMLRRPSLPHIDEVIPQDSNPANYSDRSDYLSVDQNANNHNGALSEQTYNNIMKSSMISLPIEKDDATMALRKLVSRE D6E5DA379605650A rlf2_yeast Chromatin assembly factor 1 subunit p90 RLF2 CAC1 YPR018W YP9531.12 CAF-1 90 kDa subunit RAP1 localization factor 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEQHLKSIPLQDDTKKKGILSFFQNTTTVKSNKFLTKEKDVITLDDPKEDVSGPMIETVKQETMKSINKECADEMKTTPKKANAEDKLLCYKNSPIQSTKYDRNTNKQVPNGNIIAIETKSRSSSPCSKRELSSSKKEEAKREKELKKQQRAEEKHRKELLRQEEKKKKELKVEEERQRRAELKKQKEEEKRRKEEARLEAKRRKEEERLKKEEEIRLKEEAKERAQSRIGNFFKKLSDSNTPVVEKSDYEKFFLPFYAKDGVRVSNKWKLTKVELEGSKRKIDDELLNSKDKTSSDDLLNWLQSRRLPRGHKIKRKAVDVLQQMPLKEKTDDELQSLLAQVPHKYIKFYENVRPPFIGTYSMDFTLPPNDPFSTKGTGFNYDYDSDVEWVNEEEEGEVDNLESGEEEEEEEDDEDVPSEGEFDGFLDSEENSDLDGLPCAKRKFVGPLIPTICLKSNFENLSEENKRYLQQLKAEVIIETDGPIDPFKEPKTSSLPSKRSNSDLQAQTASQSQSPEKKQKAMITDPMDLLRLFDGVQDSTFSLGTVTEIAQKNLPQYNKQTIKNTIKEYAIRSSGKGDLPRKWVIKDAQNWENLRANANMPTPSL C593E6E4FE5FD778 C593E6E4FE5FD778 orc6_yeast Origin recognition complex subunit 6 YHR118C ORC6 AAP1 Origin recognition complex 50 kDa subunit ACS-associated protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL 22803C70378B7E85 22803C70378B7E85 rrm3_yeast ATP-dependent DNA helicase RRM3 RRM3 rDNA recombination mutation protein 3 RTT104 Regulation of Ty1 transposition protein 104 YHR031C protein protein yeast Saccharomyces cerevisiae Baker's yeast MFRSHASGNKKQWSKRSSNGSTPAASASGSHAYRQQTLSSFFMGCGKKSAAASKNSTTIIDLESGDEGNRNITAPPRPRLIRNNSSSLFSQSQGSFGDDDPDAEFKKLVDVPRLNSYKKSSRSLSMTSSLHKTASASTTQKTYHFDEDETLREVTSVKSNSRQLSFTSTINIEDSSMKLSTDSERPAKRSKPSMEFQGLKLTVPKKIKPLLRKTVSNMDSMNHRSASSPVVLTMEQERVVNLIVKKRTNVFYTGSAGTGKSVILQTIIRQLSSLYGKESIAITASTGLAAVTIGGSTLHKWSGIGIGNKTIDQLVKKIQSQKDLLAAWRYTKVLIIDEISMVDGNLLDKLEQIARRIRKNDDPFGGIQLVLTGDFFQLPPVAKKDEHNVVKFCFESEMWKRCIQKTILLTKVFRQQDNKLIDILNAIRYGELTVDIAKTIRNLNRDIDYADGIAPTELYATRREVELSNVKKLQSLPGDLYEFKAVDNAPERYQAILDSSLMVEKVVALKEDAQVMMLKNKPDVELVNGSLGKVLFFVTESLVVKMKEIYKIVDDEVVMDMRLVSRVIGNPLLKESKEFRQDLNARPLARLERLKILINYAVKISPHKEKFPYVRWTVGKNKYIHELMVPERFPIDIPRENVGLERTQIPLMLCWALSIHKAQGQTIQRLKVDLRRIFEAGQVYVALSRAVTMDTLQVLNFDPGKIRTNERVKDFYKRLETLK 8E0010ABB870CAB6 8E0010ABB870CAB6 orc2_yeast Origin recognition complex subunit 2 ORC2 RRR1 SIR5 YBR060C YBR0523 Origin recognition complex 71 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MLNGEDFVEHNDILSSPAKSRNVTPKRVDPHGERQLRRIHSSKKNLLERISLVGNERKNTSPDPALKPKTPSKAPRKRGRPRKIQEELTDRIKKDEKDTISSKKKRKLDKDTSGNVNEESKTSNNKQVMEKTGIKEKREREKIQVATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDSTSPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNENFQKRPRQKLFEIQKKMFPQYWFELTQGFSLLFYGVGSKRNFLEEFAIDYLSPKIAYSQLAYENELQQNKPVNSIPCLILNGYNPSCNYRDVFKEITDLLVPAELTRSETKYWGNHVILQIQKMIDFYKNQPLDIKLILVVHNLDGPSIRKNTFQTMLSFLSVIRQIAIVASTDHIYAPLLWDNMKAQNYNFVFHDISNFEPSTVESTFQDVMKMGKSDTSSGAEGAKYVLQSLTVNSKKMYKLLIETQMQNMGNLSANTGPKRGTQRTGVELKLFNHLCAADFIASNEIALRSMLREFIEHKMANITKNNSGMEIIWVPYTYAELEKLLKTVLNTL 486E3E5CE353807F 486E3E5CE353807F orc5-orc4-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 1 A Coexpression of a BD fusion of ORC5 (BD-ORC5) and an AD fusion of ORC4 (AD-ORC4) resulted in higher bgalactosidase activity than the vector-alone control orc4-orc5 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 1 A Coexpression of a BD fusion of ORC5 (BD-ORC5) and an AD fusion of ORC4 (AD-ORC4) resulted in higher bgalactosidase activity than the vector-alone control (Fig. 1a). Expression of the opposite combination (BD-ORC4 and AD-ORC5) also resulted in higher b-galactosidase activity orc2-orc5 1 5 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1 A we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), orc2-orc5-1 1 16 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 A we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), orc2-orc6 1 14 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1 A we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) orc6-orc2 1 16 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 1 A we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) orc3-orc2 1 16 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1 A we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p) orc3-orc6 1 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1 A we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) and Orc3p and Ord6p (3p-6p) orc6-orc6 1 14 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 1 A Orc5p also interacts with itself, as does Orc6p. orc5-orc5 1 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 A Orc5p also interacts with itself, as does Orc6p. orc4-orc5-1 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 1 B we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) and Orc3p and Ord6p (3p-6p) and weaker interactions between Orc1p and Ord4p (1p-4p), Orc3p and Ord4p (3p-4p) orc5-orc4-2 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 B we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) and Orc3p and Ord6p (3p-6p) and weaker interactions between Orc1p and Ord4p (1p-4p), Orc3p and Ord4p (3p-4p) orc3-orc6-1 2 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1 B we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) and Orc3p and Ord6p (3p-6p) orc6-orc3 2 6 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 1 B we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) and Orc3p and Ord6p (3p-6p) orc3-orc2-1 2 16 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1 B we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p) orc2-orc3 2 6 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1 B we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p) orc6-orc2-1 2 14 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 1 B we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) orc2-orc5-2 2 5 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 1 B we used yeast two-hybrid analysis to examine the interaction between ORC subunits and to search for ORC-binding proteins. As well as the known Orc4p-Orc5p interaction, we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p) orc1-orc4 2 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 1 B orc4-orc1 2 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 1 B orc3-orc4 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association 1 B we revealed strong interactions between Orc2p and Ord3p (2p-3p), Orc2p and Ord5p (2p-5p), Orc2p and Ord6p (2p-6p) and Orc3p and Ord6p (3p-6p) and weaker interactions between Orc1p and Ord4p (1p-4p), Orc3p and Ord4p (3p-4p) orc3-orc5 2 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 1 B orc6-orc5 2 5 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 1 B orc3-orc3 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1 B orc5-orc5-1 2 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 1 B orc6-orc6-1 2 14 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 1 B sir4-orc2 3 7 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association we finally selected Sir4p and Mad1p as Orc2p-interacting proteins 3 A mad1-orc2 3 9 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association we finally selected Sir4p and Mad1p as Orc2p-interacting proteins 3 A cac1-orc3 3 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 3 B we finally selected Sir4p and Mad1p as Orc2p-interacting proteins, Cac1p and Ykr077wp as Orc3p-interacting proteins ykr077w-orc3 3 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 3 B we finally selected Sir4p and Mad1p as Orc2p-interacting proteins, Cac1p and Ykr077wp as Orc3p-interacting proteins rrm3-orc5 3 15 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 3 C we finally selected Sir4p and Mad1p as Orc2p-interacting proteins, Cac1p and Ykr077wp as Orc3p-interacting proteins, Rrm3p and Swi6p as Orc5p-interacting proteins, swi6-orc5 3 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 3 C we finally selected Sir4p and Mad1p as Orc2p-interacting proteins, Cac1p and Ykr077wp as Orc3p-interacting proteins, Rrm3p and Swi6p as Orc5p-interacting proteins, mih1-orc6 3 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association we finally selected Sir4p and Mad1p as Orc2p-interacting proteins, Cac1p and Ykr077wp as Orc3p-interacting proteins, Rrm3p and Swi6p as Orc5p-interacting proteins, and Mih1p as an Orc6p-interacting protein. 3 D orc3-cac1 1 6 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 4 A Yeast two-hybrid analysis confirmed that full length Cac1p interacts with Orc3p orc5-cac1 1 5 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 4 A Cac1p can also interact with Orc5p and Orc6p. orc6-cac1 1 14 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 4 A Cac1p can also interact with Orc5p and Orc6p. orc6-mih1 1 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 4 B We confirmed that full length Mih1p interacts with Orc6p. orc2-mih1 1 11 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 4 B Mih1p can also interact with Orc2p, Orc3p and Orc5p. orc3-mih1 1 11 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 4 B Mih1p can also interact with Orc2p, Orc3p and Orc5p. orc5-mih1 1 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 4 B Mih1p can also interact with Orc2p, Orc3p and Orc5p.