IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. Identity of Cdh1 and Cdc20 supplied by author sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. Identity of Cdh1 and Cdc20 supplied by author sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling. Cell (0092-8674) 2007 imex curation Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. sasakawa@ims.u-tokyo.ac.jp 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA davet Only protein-protein interactions 15 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Iwai H., Kim M., Yoshikawa Y., Ashida H., Ogawa M., Fujita Y., Muller D., Kirikae T., Jackson PK., Kotani S., Sasakawa C. HeLa cells were infected a Shigella strain which expressed IpaBFLAG from an endogenous 220 kb plasmid and carried deltadapB so that intracellular Shigella would not kill the host cells in medium depleted of diaminopimelic acids. sasakawa@ims.u-tokyo.ac.jp Accepted 2007-NOV-3 by DAVET. 13-Nov-2007: Contacted by JYOTI. Hela cell cDNA Cell (0092-8674) 2007 davet Only protein-protein interactions 15 imex curation cdc20_human Cell division cycle protein 20 homolog CDC20 p55CDC protein protein human Homo sapiens Human MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR DIP protein Q12834 original sequence version: 132 DIP protein Q12834 original sequence version: 74 DIP protein Q12834 original sequence version: 100 DIP protein Q12834 original sequence version: 118 DIP protein Q12834 original sequence version: 125 DIP protein Q12834 original sequence version: 114 DIP protein Q12834 original sequence version: 147 DIP protein Q12834 original sequence version: 162 FD5C967AF84089E8 fzr1_human Fizzy-related protein homolog FYR FZR KIAA1242 FZR1 CDH1 Cdh1/Hct1 homolog CDC20-like protein 1 protein protein human Homo sapiens Human MDQDYERRLLRQIVIQNENTMPRVTEMRRTLTPASSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLSVEGDSVTSVGWSERGNLVAVGTHKGFVQIWDAAAGKKLSMLEGHTARVGALAWNAEQLSSGSRDRMILQRDIRTPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSLSPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANELVSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVKWESVSVLNLFTRIR DIP protein Q9UM11 original sequence version: 100 DIP protein Q9UM11 original sequence version: 131 DIP protein Q9UM11 original sequence version: 136 DIP protein Q9UM11 original sequence version: 145 F6C8FDAF81D8103A fbx5_human F-box only protein 5 FBXO5 EMI1 FBX5 Early mitotic inhibitor 1 protein protein human Homo sapiens Human MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGRLVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSRLYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAKRNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTTWKKILEDDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGDQKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCSDGKLLKASCKIGPLPGTKKSKKNLRRL 196FBC2578F92120 md2l2_human Mitotic spindle assembly checkpoint protein MAD2B MAD2L2 MAD2B REV7 Mitotic arrest deficient 2-like protein 2 REV7 homolog protein protein human Homo sapiens Human MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS 1DE6353EF7D650B9 ipgc_shifl Chaperone protein IpgC ipgC ippI CP0129 protein protein shifl Shigella flexneri MSLNITENESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQDIKE DIP protein P0A2U4 original sequence version: 58 F46E39A92B8ADEC7 cdc27_human Cell division cycle protein 27 homolog CDC27 D0S1430E D17S978E CDC27 homolog H-NUC ANAPC3 Anaphase-promoting complex subunit 3 protein protein human Homo sapiens Human MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQSSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF DIP protein P30260 original sequence version: 141 DIP protein P30260 original sequence version: 111 DIP protein P30260 original sequence version: 117 DIP protein P30260 original sequence version: 135 DIP protein P30260 original sequence version: 148 DIP protein P30260 original sequence version: 153 DIP protein P30260 original sequence version: 157 DIP protein P30260 original sequence version: 162 DIP protein P30260 original sequence version: 171 DIP protein P30260 original sequence version: 118 E6C8F59C1EF1DCBA ipab_shifl Invasin IpaB 62 kDa antigen ipaB CP0128 protein protein shifl Shigella flexneri MHNVSTTTTGFPLAKILTSTELGDNTIQAANDAANKLFSLTIADLTANQNINTTNAHSTSNILIPELKAPKSLNASSQLTLLIGNLIQILGEKSLTALTNKITAWKSQQQARQQKNLEFSDKINTLLSETEGLTRDYEKQINKLKNADSKIKDLENKINQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTGLASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGCVGKILGALLTIVSVVAAAFSGGASLALAAVGLALMVTDAIVQAATGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA DIP protein P18011 original sequence version: 101 56325105E4BC0F70 ipab-mad2l2-1 1 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association To explore the role of IpaB delivered into epithelial cells during Shigella infection of intestine, we performed yeast two-hybrid screening of HeLa cDNA library and found that IpaB interacted with Mad2L2, an APC inhibitor ipab-mad2l2-2 2 15 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey physical association physical association To explore the role of IpaB delivered into epithelial cells during Shigella infection of intestine, we performed yeast two-hybrid screening of HeLa cDNA library and found that IpaB interacted with Mad2L2, an APC inhibitor 1A & Supp S5A & 5B ipab-ipac-1 2 15 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P18011:p.Leu67Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:32:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu67ala' Tue Jun 30 17:06:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu67Ala' 13 unspecified role unspecified role prey prey physical association physical association 1A * Supp S5A & 5B ipab-mad2l2-3 7 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey physical association physical association IpaB bound to Mad2L2 in the GST-pull down assay 1B ipab-mad2l2-4 7 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association IpaB1-312 bound to MBP-Mad2L2 in the MBP pull-down assay 1B ipab-mad2l2-5 8 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association Cell lysates from HeLa cells infected with WT/IpaBFLAG were immunoprecipitated with anti-FLAG antibody or mouse IgG, and then immunoblotted with anti-Mad2L2 or -FLAG antibodies (left) 1C ipab-mad2l2-6 3 15 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization lthough GFP-IpaB1-312 was detected in the cytoplasm by 3 hr after DTB, IpaB and Mad2L2 were detected in the nucleus between 6 and 12 hr (Figure 2), suggesting that IpaB interacts with Mad2L2 in the G2/M phase. 2 mad2l2-cdc27-1 5 14 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Co-precipitation of endogenous Mad2L2 and APC3. Fig. Supp. 3A & 3B mad2l2-cdc27-2 5 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Co-precipitation of endogenous Mad2L2 and APC3. Fig. Supp. 3A emi1-cdc27-1 5 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Co-precipitation of endogenous Mad2L2 and APC3. Fig. Supp. 3A & 3B ipab-mad2l2-7 7 15 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P18011:p.Asn61Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 19:53:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn61ala' Tue Jun 30 16:17:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn61Ala' 12 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 58 62 physical association physical association IpaB bound to Mad2L2 in the GST-pull down assay 1B, Supp 5C and Supp 6B mad2l2-cdc20-1 4 9 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A mad2l2-fzr-1 4 10 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5A Mad2L2 bound Cdh1. mad2l2-fzr-2 6 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Fig. 5B & 5C When 35S-Cdc20 or 35S-Cdh1 was mixed with MBP-Mad2L2, Cdh1 and Cdc20 were precipitated by MBP-Mad2L2, but not by MBP alone When Cdh1 was pulled down after incubation with MBP-Mad2L2 in the presence of IpaB1-312WT the amounts of 3Cdh1 bound to MBP-Mad2L2 decreased as the amounts of IpaB1-312WT increased mad2l2-cdc20-2 6 9 unspecified role unspecified role prey prey in vitro In vitro 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B & 5C When 35S-Cdc20 or 35S-Cdh1 was mixed with MBP-Mad2L2, Cdh1 and Cdc20 were precipitated by MBP-Mad2L2, but not by MBP alone When Cdc20 was pulled down after incubation with MBP-Mad2L2 in the presence of IpaB1-312WT , the amounts of Cdc20 bound to MBP-Mad2L2 decreased as the amounts of IpaB1-312WT increased.