MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A sequential program of dual phosphorylation of KaiC as a basis for circadian rhythm in cyanobacteria. A sequential program of dual phosphorylation of KaiC as a basis for circadian rhythm in cyanobacteria. EMBO J. (0261-4189) 2007 imex curation Nishiwaki T., Satomi Y., Kitayama Y., Terauchi K., Kiyohara R., Takao T., Kondo T. 2009-01-08 Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Nishiwaki T., Satomi Y., Kitayama Y., Terauchi K., Kiyohara R., Takao T., Kondo T. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation kaia_theeb Circadian clock protein KaiA kaiA tlr0481 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAQSTALTICGLVYSPAIGQELVRLHTSDIDELVYFSSEREFCNYLEARRNSIACLILEWGEGTPQIITYLHHSATLLPAILIFPAAPAPPPAGPHYHIAEVILTTDQLDQLNRQIEEAITGFVKLCPGCAVPPHVLFRLPALKESSNVDPQHRLSQKLKERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELMDTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPREV D3B0DCBE8A580B4E D3B0DCBE8A580B4E kaib_theeb Circadian clock protein KaiB kaiB tlr0482 protein protein theeb Thermosynechococcus elongatus (strain BP-1) MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE BC6B71EFBE6254E3 mint Component of the kaiABC clock protein complex, which constitutes the main circadian regulator in cyanobacteria. The kaiABC complex may act as a promoter-non-specific transcription regulator that represses transcription, possibly by acting on the state of chromosome compaction. In the complex, it decreases the phosphorylation status of kaiC. It has no effect on kaiC by itself, but instead needs the presence of both kaiA and kaiC, suggesting that it acts by antagonizing the interaction between kaiA and kaiC BC6B71EFBE6254E3 kaic_theeb Circadian clock protein kinase KaiC tlr0483 kaiC protein protein theeb Thermosynechococcus elongatus (strain BP-1) MTNLPEHQSSPTEQSSAEVKKIPTMIEGFDDISHGGLPQGRTTLVSGTSGTGKTLFAVQFLYNGITIFNEPGIFVTFEESPQDIIKNALSFGWNLQSLIDQGKLFILDASPDPDGQEVAGDFDLSALIERIQYAIRKYKATRVSIDSVTAVFQQYDAASVVRREIFRLAFRLKQLGVTTIMTTERVDEYGPVARFGVEEFVSDNVVILRNVLEGERRRRTVEILKLRGTTHMKGEYPFTINNGINIFPLGAMRLTQRSSNVRVSSGVKTLDEMCGGGFFKDSIILATGATGTGKTLLVSKFLETGCQQGERALLFAYEESRAQLSRNASSWGIDFEELERRGLLRIICAYPESAGLEDHLQIIKSEIADFKPSRVAIDSLSALARGVSNNAFRQFVIGVTGFAKQEEITGFFTNTTDQFMGSNSITESHISTITDTILLLQYVEIRGEMSRAINVFKMRGSWHDKGIREYVITEKGAEIRDSFRNFEGIISGTPTRISVDEKTELARIAKGMQDLESE 34E4CDF9DE9C1824 34E4CDF9DE9C1824 kaic-kaib-3 1 kaiB 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified kaiC 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q79V60:p.Thr432Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:09:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:09:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr432ala' Tue Jun 30 17:58:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr432Ala' range MINT-5224333: original sequence: 432-432 : SNSITESHISTITDTILLLQ flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3a f3c mint kaic-kaib-4 1 kaiB 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified kaiC 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:48:32 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ser341Ala Thr432Ala range MINT-5224361: original sequence: 341-341 : WGIDFEELERRGLLRIICAY direct interaction direct interaction f3a f3c mint kaic-kaia-8 1 kaiC 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q79V60:p.Thr432Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Tue Jul 12 10:12:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 14:57:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr432ala' Tue Jun 30 16:02:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr432Ala' range MINT-5224376: original sequence: 432-432 : SNSITESHISTITDTILLLQ flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined kaiB kaiA 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f3a f3c Binding occurs only in presence of KaiB Binding occurs only in presence of KaiB mint kaic-kaia-9 1 kaiC 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:50:24 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' Ser341Ala Thr432Ala range MINT-5224393: original sequence: 341-341 : WGIDFEELERRGLLRIICAY flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined kaiB kaiA 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f3a f3c Binding occurs only in presence of KaiB Binding occurs only in presence of KaiB mint