MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of a calmodulin-regulated autoinhibited Ca2+-ATPase (ACA11) that is localized to vacuole membranes in Arabidopsis. Identification of a calmodulin-regulated autoinhibited Ca2+-ATPase (ACA11) that is localized to vacuole membranes in Arabidopsis. FEBS Lett. (0014-5793) 2007 imex curation Lee SM., Kim HS., Han HJ., Moon BC., Kim CY., Harper JF., Chung WS. 2009-01-08 Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Lee SM., Kim HS., Han HJ., Moon BC., Kim CY., Harper JF., Chung WS. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Identification of a calmodulin-regulated autoinhibited Ca2+-ATPase (ACA11) that is localized to vacuole membranes in Arabidopsis. Identification of a calmodulin-regulated autoinhibited Ca2+-ATPase (ACA11) that is localized to vacuole membranes in Arabidopsis. FEBS Lett. (0014-5793) 2007 imex curation Lee SM., Kim HS., Han HJ., Moon BC., Kim CY., Harper JF., Chung WS. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lee SM., Kim HS., Han HJ., Moon BC., Kim CY., Harper JF., Chung WS. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation aca11_arath Putative calcium-transporting ATPase 11, plasma membrane-type ACA11 At3g57330 F28O9.180 Ca(2+)-ATPase isoform 11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNLLKDFEVASKNPSLEARQRWRSSVGLVKNRARRFRMISNLDKLAENEKKRCQIQEKIRVVFYVQKAAFQFIDAGARPEYKLTDEVKKAGFYVEADELASMVRNHDTKSLTKIGGPEGIAQKVSVSLAEGVRSSELHIREKIYGENRYTEKPARSFLTFVWEALQDITLIILMVCAVVSIGVGVATEGFPKGMYDGTGILLSIILVVMVTAISDYKQSLQFRDLDREKKKIIIQVTRDGSRQEVSIHDLVVGDVVHLSIGDQVPADGIFISGYNLEIDESSLSGESEPSHVNKEKPFLLSGTKVQNGSAKMLVTTVGMRTEWGKLMDTLSEGGEDETPLQVKLNGVATIIGKIGLGFAVLTFVVLCIRFVVEKATAGSITEWSSEDALTLLDYFAIAVTIIVVAVPEGLPLAVTLSLAFAMKQLMSDRALVRHLAACETMGSSTCICTDKTGTLTTNHMVVNKVWICENIKERQEENFQLNLSEQVKNILIQAIFQNTGSEVVKDKEGKTQILGSPTERAILEFGLLLGGDVDTQRREHKILKIEPFNSDKKKMSVLTSHSGGKVRAFCKGASEIVLKMCEKVVDSNGESVPLSEEKIASISDVIEGFASEALRTLCLVYTDLDEAPRGDLPNGGYTLVAVVGIKDPVRPGVREAVQTCQAAGITVRMVTGDNISTAKAIAKECGILTAGGVAIEGSDFRNLPPHEMRAILPKIQVMARSLPLDKHTLVNNLRKMGEVVAVTGDGTNDAPALHEADIGLAMGIAGTEVAKENADVIIMDDNFATIVNVAKWGRAVYINIQKFVQFQLTVNVVALIINFVSACITGSAPLTAVQLLWVNMIMDTLGALALATEPPNEGLMKRQPIGRTASFITRAMWRNIIGQSIYQLIVLGILNFAGKQILNLNGPDSTIVLNTIIFNSFVFCQVFNEVNSREIEKINVFEGMFKSWVFVAVMTATVGFQVIIVEFLGAFASTVPLSWQHWLLCILIGSVSMILAVGLKCIPVESNRHHDGYELLPSGPSDSA mint This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles 5488C4046D7F308F calm1_arath Calmodulin-1/4 CAM1 At5g37780 K22F20.2 T31G3.3 CAM4 At1g66410 T27F4.1 F28G11.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK 805B06B97552ECC1 aca11-cam1 2 ACA11 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined calmodulin 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction F5B FEBS-Letters mint cam1-aca11 1 ACA11 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined calmodulin 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association F4 FEBS-Letters mint