IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis. Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis. Plant Cell (1040-4651) 2007 Tominaga R., Iwata M., Okada K., Wada T. The authors present evidence in Figure 7 that chimeric proteins constructed from WER and CPC proteins interact with GL3 and EGL3 proteins. However they do not demonstrate that interaction sites differ between wild type (e.g CPC or WER) or chimeric (WER+CPC) proteins differ. Therefore the chimeric protein results are not recorded here. twada@psc.riken.jp 22-Jan-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Tominaga R., Iwata M., Okada K., Wada T. The authors present evidence in Figure 7 that chimeric proteins constructed from WER and CPC proteins interact with GL3 and EGL3 proteins. However they do not demonstrate that interaction sites differ between wild type (e.g CPC or WER) or chimeric (WER+CPC) proteins differ. Therefore the chimeric protein results are not recorded here. twada@psc.riken.jp Accepted 2007-DEC-14 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis. Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis. Plant Cell (1040-4651) 2007 Tominaga R., Iwata M., Okada K., Wada T. The authors present evidence in Figure 7 that chimeric proteins constructed from WER and CPC proteins interact with GL3 and EGL3 proteins. However they do not demonstrate that interaction sites differ between wild type (e.g CPC or WER) or chimeric (WER+CPC) proteins differ. Therefore the chimeric protein results are not recorded here. twada@psc.riken.jp 22-Jan-2008: Contacted by JYOTI. orchard in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Tominaga R., Iwata M., Okada K., Wada T. The authors present evidence in Figure 7 that chimeric proteins constructed from WER and CPC proteins interact with GL3 and EGL3 proteins. However they do not demonstrate that interaction sites differ between wild type (e.g CPC or WER) or chimeric (WER+CPC) proteins differ. Therefore the chimeric protein results are not recorded here. twada@psc.riken.jp Accepted 2007-DEC-14 by ORCHARD. 22-Jan-2008: Contacted by JYOTI. Plant Cell (1040-4651) 2007 orchard Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis. Functional analysis of the epidermal-specific MYB genes CAPRICE and WEREWOLF in Arabidopsis. Plant Cell (1040-4651) 2007 Tominaga R., Iwata M., Okada K., Wada T. The authors present evidence in Figure 7 that chimeric proteins constructed from WER and CPC proteins interact with GL3 and EGL3 proteins. However they do not demonstrate that interaction sites differ between wild type (e.g CPC or WER) or chimeric (WER+CPC) proteins differ. Therefore the chimeric protein results are not recorded here. twada@psc.riken.jp 22-Jan-2008: Contacted by JYOTI. orchard yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tominaga R., Iwata M., Okada K., Wada T. The authors present evidence in Figure 7 that chimeric proteins constructed from WER and CPC proteins interact with GL3 and EGL3 proteins. However they do not demonstrate that interaction sites differ between wild type (e.g CPC or WER) or chimeric (WER+CPC) proteins differ. Therefore the chimeric protein results are not recorded here. twada@psc.riken.jp Accepted 2007-DEC-14 by ORCHARD. Plant Cell (1040-4651) 2007 orchard gl2mbs_arath_dna GL2 MYB binding site nucleic acid nucleic acid arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress GACTAACGGTAAG This oligonucleotide represents the GL2 MYB binding site CD388B1EFAE37EBD cpc_arath Transcription factor CPC Protein CAPRICE At2g46410 CPC F11C10.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFRSDKAEKMDKRRRRQSKAKASCSEEVSSIEWEAVKMSEEEEDLISRMYKLVGDRWELIAGRIPGRTPEEIERYWLMKHGVVFANRRRDFFRK 608B1C7B4BA48846 egl1_arath Transcription factor EGL1 Protein ENHANCER OF GLABRA 3 Basic helix-loop-helix protein 2 BHLH2 EGL3 EGL1 MYC146 At1g63650 F24D7.16 EN30 Transcription factor EN 30 bHLH transcription factor bHLH002 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGENRTVPDNLKKQLAVSVRNIQWSYGIFWSVSASQPGVLEWGDGYYNGDIKTRKTIQAAEVKIDQLGLERSEQLRELYESLSLAESSASGSSQVTRRASAAALSPEDLTDTEWYYLVCMSFVFNIGEGIPGGALSNGEPIWLCNAETADSKVFTRSLLAKSASLQTVVCFPFLGGVLEIGTTEHIKEDMNVIQSVKTLFLEAPPYTTISTRSDYQEIFDPLSDDKYTPVFITEAFPTTSTSGFEQEPEDHDSFINDGGASQVQSWQFVGEEISNCIHQSLNSSDCVSQTFVGTTGRLACDPRKSRIQRLGQIQEQSNHVNMDDDVHYQGVISTIFKTTHQLILGPQFQNFDKRSSFTRWKRSSSVKTLGEKSQKMIKKILFEVPLMNKKEELLPDTPEETGNHALSEKKRREKLNERFMTLRSIIPSISKIDKVSILDDTIEYLQDLQKRVQELESCRESADTETRITMMKRKKPDDEEERASANCMNSKRKGSDVNVGEDEPADIGYAGLTDNLRISSLGNEVVIELRCAWREGILLEIMDVISDLNLDSHSVQSSTGDGLLCLTVNCKHKGTKIATTGMIQEALQRVAWIC 6B934DFBE82AA102 gl3_arath Transcription factor GLABRA 3 Basic helix-loop-helix protein 1 Protein SHAPESHIFTER At5g41315 GL3 BHLH1 MYC6 SST MYC6.2 EN31 Transcription factor EN 31 bHLH transcription factor bHLH001 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATGQNRTTVPENLKKHLAVSVRNIQWSYGIFWSVSASQSGVLEWGDGYYNGDIKTRKTIQASEIKADQLGLRRSEQLSELYESLSVAESSSSGVAAGSQVTRRASAAALSPEDLADTEWYYLVCMSFVFNIGEGMPGRTFANGEPIWLCNAHTADSKVFSRSLLAKSAAVKTVVCFPFLGGVVEIGTTEHITEDMNVIQCVKTSFLEAPDPYATILPARSDYHIDNVLDPQQILGDEIYAPMFSTEPFPTASPSRTTNGFDQEHEQVADDHDSFMTERITGGASQVQSWQLMDDELSNCVHQSLNSSDCVSQTFVEGAAGRVAYGARKSRVQRLGQIQEQQRNVKTLSFDPRNDDVHYQSVISTIFKTNHQLILGPQFRNCDKQSSFTRWKKSSSSSSGTATVTAPSQGMLKKIIFDVPRVHQKEKLMLDSPEARDETGNHAVLEKKRREKLNERFMTLRKIIPSINKIDKVSILDDTIEYLQELERRVQELESCRESTDTETRGTMTMKRKKPCDAGERTSANCANNETGNGKKVSVNNVGEAEPADTGFTGLTDNLRIGSFGNEVVIELRCAWREGVLLEIMDVISDLHLDSHSVQSSTGDGLLCLTVNCKHKGSKIATPGMIKEALQRVAWIC 5225EF0E9745CDB7 wer_arath Transcription factor WER Protein WEREWOLF Myb-related protein 66 WER MYB66 At5g14750 T9L3.50 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRKKVSSSGDEGNNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKDQKTKQSNGDIVYQINLPNPTETSEETKISNIVDNNNILGDEIQEDHQGSNYLSSLWVHEDEFELSTLTNMMDFIDGHCF EFAB8A342F0FB66F wer-gl3 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 7 Supplementary Figure 2 WER protein physically interacts with either of the GL3 or EGL3 proteins in yeast cells wer-egl3 3 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 7; supplementary Figure 2 WER protein physically interacts with either of the GL3 or EGL3 proteins in yeast cells wer-gl3-1 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role ancillary ancillary physical association physical association 7 CPC and CPC Chimera Proteins Compete with WER for Binding Sites on GL3 or EGL3 CPC competed against WER for binding to GL3. wer-egl3-1 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 5 unspecified role unspecified role ancillary ancillary physical association physical association 7 CPC and CPC Chimera Proteins Compete with WER for Binding Sites on GL3 or EGL3 CPC competed against WER for binding to EGL3. wer-dna 2 8 unspecified role unspecified role bait bait region R3 region of MYB DNA binding site required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey direct interaction direct interaction 8 Previously, it has been shown by gel mobility shift experiments that WER binds to the GL2 MYB binding site (GL2MBS1 [GACTAACGGTAAG]) The removal of the R3 region of the WER protein abolished binding of the protein to the oligonucleotide (Figure 8A). The addition of the R3 region to a chimeric protein construct promoted dna binding (Figure 8B). The coordinates of this region were taken from Figure 1.