MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. EMBO J. (0261-4189) 2007 imex curation Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. EMBO J. (0261-4189) 2007 imex curation Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. Only protein-protein interactions crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. EMBO J. (0261-4189) 2007 imex curation Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. Only protein-protein interactions xenla-animal_cap Xenopus laevis animal cap animal_cap Animal cap Xenopus laevis animal cap cells are cells situated around the animal (pigmented) pole of a blastula or very early gastrula-stage embryo. This tissue is fated to become cement gland/neurectoderm on the dorsal side of the embryo and epidermis on the ventral side. Animal caps are composed of pluripotent cells that can be induced to form endodermal, mesodermal, or ectodermal cell types. XAO:0000036. fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. XRab40 and XCullin5 form a ubiquitin ligase complex essential for the noncanonical Wnt pathway. EMBO J. (0261-4189) 2007 imex curation Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Lee RH., Iioka H., Ohashi M., Iemura S., Natsume T., Kinoshita N. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation q7zx67_xenla Small monomeric GTPase rap2a.S rap2a XELAEV_18015658mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSNEGRALAEDWGCPFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ mint CF0C24762765E560 a4gat_human Lactosylceramide 4-alpha-galactosyltransferase A4GALT A14GALT A4GALT1 Alpha-1,4-galactosyltransferase UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase Alpha-1,4-N-acetylglucosaminyltransferase Alpha4Gal-T1 Globotriaosylceramide synthase CD77 synthase P1/Pk synthase protein protein human Homo sapiens Human MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKGQLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVESAARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELFRDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKNLRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDINPEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMKMYL mint Necessary for the biosynthesis of the Pk antigen of blood histogroup P. Catalyzes the transfer of galactose to lactosylceramide and galactosylceramide. Necessary for the synthesis of the receptor for bacterial verotoxins 8755865BDA5DA205 a7vk04_xenla cul5.L cul5 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAKIHQALKEDILDFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMGKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGVRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKEEENRALRYLETRRECNSVQALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLMDKVPNGIEPMLKDLEEHIVSAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQDDPRFLTARDKAYKAVVNDAAIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTPLSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWLREVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSANIKILNAGAWSRSSEKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQLAVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLSYEPTVNSPKDFTEGTLFSVNQEFGLIKNGKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAIIQIMKMRKKITNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDECDINTFLYMA mint 7648A640CC8A6340 q6ddz8_xenla mink1.L mink mink1 XELAEV_18019343mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASDPPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEINMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRGLSHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPKLKSKKWSKKFIDFIDTCLIKNYMSRPPTEPLLKHPFIRDQPTERQVRIQLKDHIDRSRKKRGEKDETEYEYSGSEDEEENHGDEGEPSSIMNVPGESTLRREFLRLQQENKSNSEALKQQQVGAQHRDSEAHIKQLLHERQRRIEEQKEERRRVEEQQRREREQRKQQEKEQQRRRDDIRREEERRMAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQQQQQQQQQQKQQQEKKPLYHYNRGVMNPSEKPAWAREVEERSRLNKQSSPLAITKLSSVESAGNPSQTPPSQRPPEIQEHKPLRTTPQNRAAFRPTPRPNSLQDPLAPPVRHAPVPPPADRNHLSRQSSDPSPDGGPPSSRLERGPWVKLQPEVHPPKVPQRTTSIATALNTSGSGGSRPVQQGQPVRASNPDLRRAESGWERGDSLLQSPHPNLPQAGSLERNRIAPHKLEESSISPPGSKTPGEEHRSRPGRPADHLLVKDRPEDVPKAPKKALDYSSSSDELDSSDEEEEEGDAERQEPSRDSSGASRSGRDADTDSVSTMVVHDVEELMGSTSDSSYGDGTMVVQRTPEEERSLLHADSNGYTNLPDVVQPSHSPTEPKGQGTSPSKEGNGSDYQSRGLVKAPPKTSFTMFVDLGLYQSSGGGGDTIPVAASYVSGDPARLEQLKYEARKGSVVNVNPTNTRPHSDTPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGKVYTLITRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWSTVGDMDGCVHYKVVKYERIKFLVIALKNSVEVYAWAPKPYHKFMAFKSFTDIPHRPQLVDLTVEEGQRLKVIYGSCSGFHAVDVDSGNNYDIYIPVHIQSQINPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAYICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLNRSCIMNW 70E6DC385112F3C8 q6phl7_xenla elob.L elob tceb2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDVFLMIRHHKTTIFTDAKENTTVYELKRIVEGILKRPPEDQKLYKDDQLLDDNKTLGDCGFTSQTARPQAPATVGLAFRSSGDSFEPLRVEPFSSPPELPDVMKPQETSGSANEQAVQ mint 3DFA186A7B341ED9 q5xhf6_xenla rab40c.S rab40 rab40c XELAEV_18047665mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYSYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARSYAEKNGMTFFEVSPLCNFNVTESFTELSRIVLMRHGMEKMWRPNKVFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRSKSIRPPQSPPQNCSRTNCKIS mint B58DE4D6485EC347 goga2_human Golgin subfamily A member 2 GOLGA2 130 kDa cis-Golgi matrix protein GM130 autoantigen Golgin-95 protein protein human Homo sapiens Human MWPQPRLPPRPAMSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLELYKNTQSNEDLKQEKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPDANQQLQQAMEERAQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEKECSMSRVQELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDNEGLSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAELQSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQRDQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLESREAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNPADEPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQNPRERPGLGSNPCIPFFYRADENDEVKITVI BD067145C5092237 dvl1_human Segment polarity protein dishevelled homolog DVL-1 DVL1 DSH homolog 1 protein protein human Homo sapiens Human MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSASTALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQADRASSFSSITDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDPAAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGTSDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM DIP protein O14640 original sequence version: 114 B009BDBCC57BD562 ubiqp_xenla Polyubiquitin protein protein xenla Xenopus laevis (African clawed frog) African clawed frog QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG DIP protein P62972 original sequence version: 41 9C8F431544081131 q6phw7_xenla Elongin-C eloc.L eloc tceb1 XELAEV_18031836mg XELAEV_18033803mg protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC mint 98D88696E883538B rab40c-tceb1 1 rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-5223409: original sequence: 1-282 : MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYSYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARSYAEKNGMTFFEVSPLCNFNVTESFTELSRIVLMRHGMEKMWRPNKVFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRSKSIRPPQSPPQNCSRT tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined elongin c 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2A mint rab40c-rap2a 1 Rap2 5 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-5223406: original sequence: 1-282 : MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYSYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARSYAEKNGMTFFEVSPLCNFNVTESFTELSRIVLMRHGMEKMWRPNKVFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRSKSIRPPQSPPQNCSRT physical association physical association F2A mint rab40c-tceb1-1 4 rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-5210514: original sequence: 189-266 : VFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRS gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined elongin c 14 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C domino mint rab40c-tceb2 4 elongin b 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-5210556: original sequence: 189-266 : VFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRS physical association physical association F2C domino mint rab40c-rap2a-1 4 rap2 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified undefined mutation mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 17:04:03 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation increasing' range MINT-5210749: original sequence: 189-266 : VFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRS gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C F2D mint rab40c-cul5-2 4 rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-5223395: original sequence: 189-266 : VFSLQDLCCRAIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRSYSVAGSSGGATGSGGGSKGNSLKRS elongin c cullin 5 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F2C domino mint rap2a-mink1-5 4 rap2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified mink 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7a mint dvl1-mink1 4 mink 8 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Dsh 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified physical association physical association f7a mint rap2a-ubiqp 4 rap2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Ubiquitin 13 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F6f mint rab40c-rap2a-2 3 rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RAP2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F6A F6B Same colocalization occurs in CHO cells. Same colocalization occurs in CHO cells. mint mink1-rap2a 3 RAP2 5 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab40 mink 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F7B mint a4galt-rab40c 2 1.4-galactosyltransferase 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4A mint rab40c-tceb1-2 2 elongin c 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4c mint cul5-rab40c 2 rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cullin 5 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization F4D mint golga2-rab40c 2 rab40 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GM130 11 immunostaining immunostaining predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F4B mint