MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. EMBO J. (0261-4189) 2007 imex curation Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. EMBO J. (0261-4189) 2007 imex curation Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. 2009-01-08 Only protein-protein interactions in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. EMBO J. (0261-4189) 2007 imex curation Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. 2009-01-08 Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. C-reactive protein collaborates with plasma lectins to boost immune response against bacteria. EMBO J. (0261-4189) 2007 imex curation Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. 2009-01-08 Only protein-protein interactions human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ng PM., Le Saux A., Lee CM., Tan NS., Lu J., Thiel S., Ho B., Ding JL. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation a1kyq1_carro protein protein mangrove horseshoe c Carcinoscorpius rotundicauda Mangrove horseshoe crab Limulus rotundicauda MYNTVKILSILTFFALTQADVHHHTACNTVGSLKGIVDSVTELVDLARERISTLEDVFSTTTLQQTFPPIVNDKQNRSFQQSLYVTQTTEQKPPLPEDCASIYQQQLNRTSGVYSIQPRFLNQSIYVFRDMETSGGGWTLIQRRGDFGKPFENFYRSWVEYKNGFGNLTQEFWLGNDIIFSLTNQDNMVLRVDLEDFKGSRRYAEYDEFLVRSERELYKMSYKTYKGDAGNSLAHHNNMMFSTKDKDNDNYKDSCAQTYKGGWWKCK fragmentation type: fragment mint D35AD225DB7FA912 fcn1_human Ficolin-1 FCN1 FCNM Collagen/fibrinogen domain-containing protein 1 Ficolin-A Ficolin-alpha M-ficolin protein protein human Homo sapiens Human MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA 184D24B371B251AB q2ts39_carro Pentaxin Pentraxin CRP-1 protein protein mangrove horseshoe c Carcinoscorpius rotundicauda Mangrove horseshoe crab Limulus rotundicauda KVKFPPSSSPSFPRLVMVGTLPDLQEITLCYWFKLHRLKGTPHIFSYANSETDNEILTSLNEQNDFLFNIHGKTQLNVQCNNKIHAGRWHHVCHTWSSWEGEATTAVDGFRCKGNATGKAMGVTFRQGGLVVLGQDQDSVGGGFDAKQSLVGELSELNLWDMVLNHEQIKHLSECVHPSERHIYGNVIHWDKTQFQAYDGVALSPNEICA fragmentation type: fragment mint 8ED7D38223E13778 crp_human C-reactive protein CRP PTX1 protein protein human Homo sapiens Human MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP 669228636A8544F6 q2ts30_carro GBP protein protein mangrove horseshoe c Carcinoscorpius rotundicauda Mangrove horseshoe crab Limulus rotundicauda MKNIMYFSLVMLLLTFLVVSPTLAEWTHINGKLSHLTVTPRFVWGVNNVHDIFRCTRPCTGSNWIKVEGSLKQIDADDHEVWGVNSNDNIYKRPVDGTGSWTQIKGGLKHVSASGYGYIWGVSSKDQIFKCPKPCNGEWELVDGSLKQVDGGRDLVYGVNQNDEIYRRPVDGSGVWENIPGKLKHISGSGSWEVFGVNCNDQIFRCKKPCSGQWVRLPGHLKQCDASGDSLMGVNSNDDIFESVPASKSCWLNPFL mint AFF32A8B6F5A568B fcn2_human Ficolin-2 FCN2 FCNL Ficolin-B Ficolin-beta L-ficolin Collagen/fibrinogen domain-containing protein 2 Serum lectin p35 37 kDa elastin-binding protein EBP-37 Hucolin protein protein human Homo sapiens Human MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA mint Calcium-dependent and GlcNAc-binding lectin. Enhanced phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region D363029846CCB3C9 crp_1-gbp 3 CRP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GBP 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mint gbp-crp_1 3 CRP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined GBP 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mint a1kyq1-gbp 3 GBP 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CRP 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3a mint gbp-a1kyq1 1 CL5 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level CRP 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level GBP 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified association association Only when hemolymph is infected. f3b Only when hemolymph is infected. mint crp-fcn2 1 CL5 L-Ficolin 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified CRP 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified direct interaction direct interaction f4a homomint mint crp_1-fcn1 1 CRP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified M-Ficolin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-5223326: original sequence: 114-326 : GPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRP direct interaction direct interaction f4b mint fcn1-crp_1 1 CRP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified M-Ficolin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-5223336: original sequence: 114-326 : GPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRP direct interaction direct interaction f4d mint crp_1-gbp-1 4 GBP 9 ms participant Identification by mass spectrometry ms participant predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CRP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f3d f3e mint crp_1-fcn1-1 2 CRP 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified M-Ficolin 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain range MINT-5223303: original sequence: 114-326 : GPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRP direct interaction direct interaction kd 4 nanomolar f4c mint