MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The p110delta isoform of PI 3-kinase negatively controls RhoA and PTEN. The p110delta isoform of PI 3-kinase negatively controls RhoA and PTEN. EMBO J. (0261-4189) 2007 imex curation Papakonstanti EA., Ridley AJ., Vanhaesebroeck B. 2009-01-08 Only protein-protein interactions mouse-bmm mouse bone marrow derived macrophages bmm bone marrow derived macrophages Bone marrow derived macrophages (BMM) were generated in vitro from precursor cells harvested from the femurs of C57BL/6 mice (7�8 weeks) by proliferation and differentiation in the presence of L-cell conditioned medium. as a source of CSF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Papakonstanti EA., Ridley AJ., Vanhaesebroeck B. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation cdn1b_mouse Cyclin-dependent kinase inhibitor 1B Cyclin-dependent kinase inhibitor p27 p27Kip1 Cdkn1b protein protein mouse Mus musculus Mouse MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIGSQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT DIP protein P46414 original sequence version: 87 BAC30D648B9BA3D6 rhoa_mouse Transforming protein RhoA Rhoa Arha Arha2 protein protein mouse Mus musculus Mouse MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLIL DIP protein Q9QUI0 original sequence version: 76 DIP protein Q9QUI0 original sequence version: 77 DIP protein Q9QUI0 original sequence version: 100 C4C8BDC31FF858BC rhoa-cdkn1b 1 3 monoclonal western monoclonal antibody western blot monoclonal western predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level p27 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F6B EMBO-Journal mint