MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis of functional cooperation of Tim15/Zim17 with yeast mitochondrial Hsp70. Structural basis of functional cooperation of Tim15/Zim17 with yeast mitochondrial Hsp70. EMBO Rep. (1469-221X) 2007 imex curation Momose T., Ohshima C., Maeda M., Endo T. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Momose T., Ohshima C., Maeda M., Endo T. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation hsp77_yeasx Import motor subunit, mitochondrial Heat shock protein SSC1, mitochondrial SSC1 ENS1 mtHSP70 Endonuclease SceI 75 kDa subunit protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MLAAKNILNRSSLSSSFRIATRLQSTKVQGSVIGIDLGTTNSAVAIMEGKVPKIIENAEGSRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPYKIVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKTETGIDLENDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTAPLVKRTVDPVKKALKDAGLSTSDISEVLLVGGMSRMPKVVETVKSLFGKDPSKAVNPDEAVAIGAAVQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAAGQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGIINVSARDKATNKDSSITVAGSSGLSENEIEQMVNDAEKFKSQDEARKQAIETANKADQLANDTENSLKEFEGKVDKAEAQKVRDQITSLKELVARVQGGEEVNAEELKTKTEELQTSSMKLFEQLYKNDSNNNNNNNNGNNAESDETKQ mint Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Constitutes the ATP-driven core of the motor and binds the precursor preprotein. Required for the import of the processed fratxin homolog YFH1 into the mitochondrion Acts as a non-catalytic component of endonuclease SceI (endo.SceI), which cleaves specifically at multiple sites on mitochondrial DNA and produces double-stranded breaks. SSC1 confers broader sequence specificity, greater stability, and higher activity on the catalytic subunit 2B08AF9E3BC21082 zim17_yeast Mitochondrial protein import protein ZIM17 TIM15 N0381 YNL310C FMP28 HEP1 mtHsp70-associated motor and chaperone protein TIM15/ZIM17 ZIM17 Mitochondrial import inner membrane translocase subunit TIM15 mtHsp70 escort protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MIPRTRTLLQSKIPITRYFARCWAPRVRYNVCRTLPAAALHTNIIAHNEVKKDDKKVHLGSFKVDKPKMMIAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHLIADHLKIFHDHHVTVEQLMKANGEQVSQDVGDLEFEDIPDSLKDVLGKYAKNNSENASQLPHPSQK 4707DD1CA1490691 zim17-ssc1 1 mtHsp70 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Tim 15 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P42844:p.Asp111Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Tue Jul 12 10:58:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:14:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp111ala' Tue Jun 30 17:16:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp111Ala' range MINT-4979147: original sequence: 111-111 : PHCKVRHLIADHLKIFHDHH gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F4A F3F EMBO-Reports homomint mint zim17-ssc1-1 1 mtHsp70 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Tim 15 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified P42844:p.Arg106Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Tue Jul 12 10:58:28 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:52:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg106ala' Tue Jun 30 19:51:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg106Ala' range MINT-4979156: original sequence: 106-106 : VLISCPHCKVRHLIADHLKI gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P42844:p.His107Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:23:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:51:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his107ala' Tue Jun 30 19:30:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His107Ala' range MINT-4979167: original sequence: 107-107 : LISCPHCKVRHLIADHLKIF direct interaction direct interaction F4A F3F EMBO-Reports homomint mint