MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Human CIA30 is involved in the early assembly of mitochondrial complex I and mutations in its gene cause disease. Human CIA30 is involved in the early assembly of mitochondrial complex I and mutations in its gene cause disease. EMBO J. (0261-4189) 2007 imex curation Dunning CJ., McKenzie M., Sugiana C., Lazarou M., Silke J., Connelly A., Fletcher JM., Kirby DM., Thorburn DR., Ryan MT. 2009-01-08 Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dunning CJ., McKenzie M., Sugiana C., Lazarou M., Silke J., Connelly A., Fletcher JM., Kirby DM., Thorburn DR., Ryan MT. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation cia30_human Complex I intermediate-associated protein 30, mitochondrial NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1 NDUFAF1 CIA30 CGI-65 protein protein human Homo sapiens Human MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQGDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQAKVVWQFRGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRSGYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDFIGVFTDPAHTEEFAYENSPELNPRLFK 13D76605CC50DFF7 ndua9_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial NADH-ubiquinone oxidoreductase 39 kDa subunit Complex I-39kD NDUFA9 NDUFS2L protein protein human Homo sapiens Human MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYIFAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI DIP protein Q16795 original sequence version: 88 66A1CC7FCE86DD0E ndua6_human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 LYRM6 NADH-ubiquinone oxidoreductase B14 subunit Complex I-B14 LYR motif-containing protein 6 NDUFA6 NADHB14 protein protein human Homo sapiens Human MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP DIP protein P56556 original sequence version: null 5EE10C571A659D8B nu1m_human NADH-ubiquinone oxidoreductase chain 1 MT-ND1 MTND1 NADH1 ND1 NADH dehydrogenase subunit 1 protein protein human Homo sapiens Human MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVAQTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT 2F771ACB95002591 ndus7_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial NADH-ubiquinone oxidoreductase 20 kDa subunit Complex I-20kD PSST subunit NDUFS7 protein protein human Homo sapiens Human MAVLSAPGLRGFRILGLRSSVGPAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR B3547EA24643C1B0 ndub6_human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 NADH-ubiquinone oxidoreductase B17 subunit Complex I-B17 NDUFB6 protein protein human Homo sapiens Human MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH E8F419F5EB154D0B ndus5_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 5 NDUFS5 NADH-ubiquinone oxidoreductase 15 kDa subunit Complex I-15 kDa protein protein human Homo sapiens Human MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP 3D55402837DD99EE ndus3_human NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial NDUFS3 NADH-ubiquinone oxidoreductase 30 kDa subunit Complex I-30kD protein protein human Homo sapiens Human MAAAAVARLWWRGILGASALTRGTGRPSVLLLPVRRESAGADTRPTVRPRNDVAHKQLSAFGEYVAEILPKYVQQVQVSCFNELEVCIHPDGVIPVLTFLRDHTNAQFKSLVDLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESAVSVFKAANWYEREIWDMFGVFFANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK C058D62779BEF17B C058D62779BEF17B ndufaf1-mt_nd1 1 NDUFB6 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level ND1 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NDUFA9 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NDUFA6 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NDUFS5 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level CIA30 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NDUFS3 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NDUFS7 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association F2 EMBO-Journal homomint mint