IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ AtCCMA interacts with AtCcmB to form a novel mitochondrial ABC transporter involved in cytochrome c maturation in Arabidopsis. AtCCMA interacts with AtCcmB to form a novel mitochondrial ABC transporter involved in cytochrome c maturation in Arabidopsis. J. Biol. Chem. (0021-9258) 2007 imex curation Rayapuram N., Hagenmuller J., Grienenberger JM., Giege P., Bonnard G. The UniProt accessions were mapped using identifiers or sequence data provided in the report. geraldine_bonnard@ibmp-ulp.u-strasbg.fr 12-Oct-2007: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rayapuram N., Hagenmuller J., Grienenberger JM., Giege P., Bonnard G. The UniProt accessions were mapped using identifiers or sequence data provided in the report. geraldine_bonnard@ibmp-ulp.u-strasbg.fr Accepted 2007-OCT-4 by JYOTI. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation ab1i_arath ABC transporter I family member 1 ABCI1 CCMA At1g63270 F9N12.11 Cytochrome c biogenesis ATP-binding export protein ccmA-like MRP-related protein 3 NAP10 Putative non-intrinsic ABC protein 10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSIRRPQIPRLLLQNVSCMRNAQQILRHVNVSLHDGGALVLTGTNGSGKSTFLRMLAGFSKPSAGEILWNGHDITQSGIFQQYKLQLNWISLKDAIKERFTVLDNVQWFELLENKIGKAQPALELMGLGRLVKEKSRMLSMGQRKRLQLARLLAIDRPIWLLDEPSVALDDEGVRLLEYIIAEHRKKGGIVIVATHLPIDIEDAMILRLPPRFPRKMTLIDMLDRADIS 48B925CC1ED796BB ccmb_arath Putative cytochrome c biogenesis ccmB-like mitochondrial protein CCMB CCB2 CCB206 AtMg00110 ABCI2 ABC transporter I family member 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRLFFELYYKLIFSSTPITSFSLFLLYIVVTPLMLGFEKDFLCHFHLGLIWISLLFSFLSALFFRNEKEDGTLELYYLSTYCLPKILLLQLVGHWVIQISCVFCGFPMLQLLYQFGRSGMDWLNILLGSLVLTLLCGIHSCLALGITSSSGWNSSQNLTTLPTLLPLTVFCTSIETEWFHVLLLIGYFFLFVSLFPISVSISLQD B5CA91DBA2DC208F ccma-ccmb 1 2 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 6B 6C Growth was observed for AtCCMA-B1, -B3, -B5, and -B7 combinations but not the others ccmb-ccmba 1 3 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role bait bait physical association physical association 6B 6C Growth was observed for AtCCMA-B1, -B3, -B5, and -B7 combinations but not the others