MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it POU-V factors antagonize maternal VegT activity and beta-Catenin signaling in Xenopus embryos. POU-V factors antagonize maternal VegT activity and beta-Catenin signaling in Xenopus embryos. EMBO J. (0261-4189) 2007 imex curation Cao Y., Siegel D., Donow C., Knöchel S., Yuan L., Knöchel W. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cao Y., Siegel D., Donow C., Knöchel S., Yuan L., Knöchel W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation POU-V factors antagonize maternal VegT activity and beta-Catenin signaling in Xenopus embryos. POU-V factors antagonize maternal VegT activity and beta-Catenin signaling in Xenopus embryos. EMBO J. (0261-4189) 2007 imex curation Cao Y., Siegel D., Donow C., Knöchel S., Yuan L., Knöchel W. 2009-01-08 Only protein-protein interactions xenla-embryo Xenopus laevis embryo embryo Embryo Defined as the development stage prior to the initiation of tissue differentiation. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cao Y., Siegel D., Donow C., Knöchel S., Yuan L., Knöchel W. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation t7l1b_xenla Transcription factor 7-like 1-B tcf7l1-b HMG box transcription factor 3-B tcf3 tcf3b protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MPQLNSGGGDELGANDELIRFKDEGEQEEKSPGEGSAEGDLADVKSSLVNESENHSSDSDSEVERRPPPRETFEKPRDYLSEAFRRQQDAAFFKGPPYAGYPFLMIPDLGGHYLPNGALSPSARAYLQMKWPLLDSPSTAGLKDARSPSPAHLSNKVPVVQHPHHMHPLTPLITYSNEHFSPGTPPGHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSIPPGGFRHPYPALAMNASMSSLVSSRFSPHMVPPPHHSLHTSGIPHPAIVSPIVKQEPSSGNISPNLSTKSNVVVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPSWSARDNYGKKKKRKREKQSPEMENYTKTKKMCVQHFPSDKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARALSHSAAFLASKSPSSSSLSGHLPSPVGSPLLSRPIPLTSSILSPPGVFPSALQALPLLQAQPLSLVTRSSD mint Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of ctnnb1-A and possibly ctnnb1-B, and as an activator in the presence of these proteins. Required early in development for the establishment of the dorsal body axis in response to maternal Wnt signaling A32111DE57877AFE p5f11_xenla POU domain, class 5, transcription factor 1.1 oct-25 pou5f1.1 POU class V protein oct-25 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MYSQQPFPAFAFNAGLMQDPANCHFGGYTGLGHPQPFSFAFSTLKSENGESGVQGMGDCTTPVMPWNSLASFDHQVQMENNQQGNPPRAPSPTLSDSRIKVKEEVVHETDSGEESPEPKYPSPPNPSLYYPNAWTGAPFWQVNPTPGNNINPMPNQTLVKNTSLPGNTTYPTPANQSPNTPVDCVTSSMESSRCSSTNSPNGAINERATTIPNGEMLDGGQSSDNEEEVPSESEMEQFAKDLKHKRVSLGYTQADVGYALGVLYGKMFSQTTICRFESLQLSFKNMCQLKPFLERWVVEAENNDNLQELINREQVIAQTRKRKRRTNIENIVKGTLESYFMKCPKPGAQEMVQIAKELNMDKDVVRVWFCNRRQKGKRQGMPTVEENDGEGYDVAQTMGSPPVGHYALQQVVTPQGYMAAPQIYASAFHKNDLFPQTVPHGMAMGGHIG mint 38430BD13CF4115F a1y9b6_xenla Oct60 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MDQPILYSQTSFP fragmentation type: fragment mint 410181A0BDFCAB57 p5f12_xenla POU domain, class 5, transcription factor 1.2 oct-91 POU class V protein oct-91 pou5f1.2 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MYNQQTYPSFTHNPALMPDGSGQYNLGTYTGMARHPHQAQAFFPFSGVKSDYGDLGGQTTSVGDTSAWNPLTSLDSANQLGISGQGNPFKNLKREREDDEEKSESPEPKCSPPSLPPAYYTHAWNPTTTFWSQVSSSGTTVVSKPLPTPLQPGDKCDPVEANKIFTSSPDKSGESGISSLDNSRCSSATSSSSGGTNVGTPRSLSRGASDGLSSDSEEEAPNSGEMEQFAKDLKHKRITMGYTQADVGYALGVLFGKTFSQTTICRFESLQLSFKNMCKLKPLLRSWLHEVENNENLQEIISRGQIIPQVQKRKHRTSIENNVKCTLENYFMQCSKPSAQEIAQIARELNMEKDVVRVWFCNRRQKGKRQVYPYIRENGGEPYDAPQTLTPPSQGPFPLPQVMPSQVFPTVPLGANPTIYVPTYHKNDMFPQAMHHGIGMGNQGN mint C981C1F3A2EDA93C vegta_xenla T-box protein VegT-A vegt-a Brachyury and Tbx-related protein T-box protein Antipodean apod brat vegt protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MRNCCRECGLSAGHLEPEASSNCASDVKSSPDMDSVSSQDSLYLPNTVGASLEDQDLWSQFHQEGTEMIITKSGRRMFPQCKIRLFGLHPYAKYMLLVDFVPLDNFRYKWNKNQWEAAGKAEPHPPCRTYVHPDSPAPGAHWMKDPICFQKLKLTNNTLDQQGHIILHSMHRYKPRFHVVQSDDMYNSPWGLVQVFSFPETEFTSVTAYQNEKITKLKINHNPFAKGFREQERSHKRDDVLKILQQSPSKRQKRKKWEDSPEADISDFPKAICVKEESIMDPAGVYQNWVSDHEANQGLTPHSPESEGANQEQQVPTSSSNFYNKSHYRRSSQHLSSPFELGEPSSRRLTPDIATVPDSDPDSLAVFHVIPTQNSAPERTCSMNFSMEAPMKQPLRGAMYSPYGADQWLVPAQGQYRPVGYTAYPTDLSTQGAVAHPHSAMSDWSQYSLFPYSCW mint Transcription factor involved in mesodermal patterning. Appears to pattern mesoderm along the dorsoventral and posterior axis. It activates WNT-8, EOMES and brachyury expression CF7FAC946A1847C0 pou5f1_1-vegt_a 1 oct-25 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined vegt 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F3A EMBO-Journal mint pou5f1_1-tcf7l1_b 1 tcf3 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated oct-25 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3A EMBO-Journal mint vegt_a-pou5f1_1 1 oct-25 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated vegt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3A EMBO-Journal mint tcf7l1_b-pou5f1_1 1 tcf3 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined oct-25 4 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F3A EMBO-Journal mint oct60-vegt_a 1 vegt 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated oct-60 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B EMBO-Journal mint pou5f1_2-tcf7l1_b 1 tcf3 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated oct-91 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B EMBO-Journal mint pou5f1_2-vegt_a 1 vegt 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated oct-91 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B EMBO-Journal mint oct60-tcf7l1_b 1 tcf3 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated oct-60 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3B EMBO-Journal mint tcf7l1_b-vegt_a 1 vegt 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated tcf3 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-4979452: original sequence: 191-397 : PEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGWLVPQQGQPMYSIPPGGFRHPYPALAMNASMSSLVSSRFSPHMVPPPHHSLHTSGIPHPAIVSPIVKQEPSSGNISPNLSTKSNVVVKKEEEKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHSLSREEQAKYYELARKERQLHSQLYPSWSARDN physical association physical association F3C F3D EMBO-Journal mint vegt_a-tcf7l1_b 1 vegt 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-4979473: original sequence: 1-230 : MRNCCRECGLSAGHLEPEASSNCASDVKSSPDMDSVSSQDSLYLPNTVGASLEDQDLWSQFHQEGTEMIITKSGRRMFPQCKIRLFGLHPYAKYMLLVDFVPLDNFRYKWNKNQWEAAGKAEPHPPCRTYVHPDSPAPGAHWMKDPICFQKLKLTNNTLDQQGHIILHSMHRYKPRFHVVQSDDMYNSPWGLVQVFSFPETEFTSVTAYQNEKITKLKINHNPFAKGFR tcf3 3 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F3C F3D EMBO-Journal mint tcf7l1_b-vegt_a-1 1 tcf3 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-5209832: original sequence: 398-551 : GKKKKRKREKQSPEMENYTKTKKMCVQHFPSDKSCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPEARALSHSAAFLASKSPSSSSLSGHLPSPVGSPLLSRPIPLTSSILSPPGVFPSALQALPLLQAQPLSLVTRSS gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined vegt 7 weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association F3C F3D EMBO-Journal mint tcf7l1_b-vegt_a-2 2 tcf3 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined vegt 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3E EMBO-Journal mint vegt_a-pou5f1_1-1 2 oct-25 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level vegt 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3E EMBO-Journal mint tcf7l1_b-pou5f1_1-1 2 oct-25 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level tcf3 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3E EMBO-Journal mint