MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. FEBS Lett. (0014-5793) 2007 imex curation Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. 2009-01-08 Only protein-protein interactions in vitro In vitro saturation binding saturation binding predetermined predetermined participant predetermined Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. FEBS Lett. (0014-5793) 2007 imex curation Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. 2009-01-08 Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation predetermined predetermined participant predetermined Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. FEBS Lett. (0014-5793) 2007 imex curation Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. FEBS Lett. (0014-5793) 2007 imex curation Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. 2009-01-08 Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. FEBS Lett. (0014-5793) 2007 imex curation Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. 2009-01-08 Only protein-protein interactions mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron imaging technique imaging technique microscopy experimental particp experimental participant identification experimental particp Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. Interaction of the Coxsackie and adenovirus receptor (CAR) with the cytoskeleton: binding to actin. FEBS Lett. (0014-5793) 2007 imex curation Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. 2009-01-08 Only protein-protein interactions in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Huang KC., Yasruel Z., Guérin C., Holland PC., Nalbantoglu J. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation cxar_mouse Coxsackievirus and adenovirus receptor homolog Cxadr Car protein protein mouse Mus musculus Mouse MARLLCFVLLCGIADFTSGLSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAGTIAGAVIGTLLALVLIGAILFCCHRKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERAPQSPTLAPAKVAAPNLSRMGAVPVMIPAQSKDGSIV mint Component of the epithelial apical junction complex that is essential for the tight junction integrity. Proposed to function as a homophilic cell adhesion molecule. Recruits MPDZ to intercellular contact sites. Probably involved in transepithelial migration of polymorphonuclear leukocytes (PMN) through adhesive interactions with AMICA1/JAML located in the plasma membrane of PMN In vitro, acts as a receptor for group B coxsackieviruses and subgroup C of adenoviruses (AD2 and AD5) 5445B4B52A34B2A2 actb_mouse Actin, cytoplasmic 1 Actb Beta-actin protein protein mouse Mus musculus Mouse MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 6AFD05CA94E360E2 cxadr-actb 3 Car 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined actin beta 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2A FEBS-Letters mint actb-cxadr 4 Car 7 polyclonal western polyclonal antibody western blot polyclonal western predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level actin beta 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F2B FEBS-Letters mint actb-cxadr-1 2 Car 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined actin beta 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified colocalization colocalization F3A F4 FEBS-Letters mint actb-cxadr-2 6 Car 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined actin beta 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F3C FEBS-Letters mint actb-cxadr-3 1 Car 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined actin beta 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F3B FEBS-Letters mint actb-cxadr-4 5 Car 7 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell actin beta 8 experimental particp experimental participant identification experimental particp predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization F5 F6 FEBS-Letters The same occurs in SH-SY5Y cells. mint