IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-hcc-1937 Homo sapiens hcc-1937 human breast carcinoma established from a primary ductal carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Coimmunoprecipitations were carried out in lysates from cells transfected with BRCA1 vector. Cells were treated with IR or untreated. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-hcc-1937 Homo sapiens hcc-1937 human breast carcinoma established from a primary ductal carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Coimmunoprecipitations were carried out in lysates from control cells - deficient in BRCA1 - not transfected with BRCA1 vector. Cells were treated with IR or untreated. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Cells were treated with siRNA oligos to Bach1 or left untreated. 48 h after treatment proteins were immunoprecipitated with antibodies to Rap80. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 tap tandem affinity purification TAP TAP tap weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Cells were treated with siRNA oligos to CtIP or left untreated. 48 h after treatment proteins were immunoprecipitated with antibodies to Rap80. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Biotin-labeled phosphorylated or unphosphorylated Abraxas peptides were conjugated onto SA-chips and purified GST-Brca1-BRCT was used as an analyte. Resonance units were measured using BIAcore 3000. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference fluorescence imaging fluorescence microscopy fluorescence imaging antibody detection identification by antibody antibody detection Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer Cells were treated with siRNA oligos to Abra1 or left untreated. 48 h after treatment proteins were immunoprecipitated with antibodies to Rap80. The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response. Science (0036-8075) 2007 imex curation Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu 07-Aug-2007: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Wang B., Matsuoka S., Ballif BA., Zhang D., Smogorzewska A., Gygi SP., Elledge SJ. Cancer - Interactions investigated in the context of cancer The authors confirmed that all constructs used were of human origin. selledge@genetics.med.harvard.edu Accepted 2007-JUL-21 by JYOTI. 07-Aug-2007: Contacted by JYOTI. Science (0036-8075) 2007 Only protein-protein interactions imex curation fancj_human Fanconi anemia group J protein BRIP1 BACH1 FANCJ ATP-dependent RNA helicase BRIP1 BRCA1-associated C-terminal helicase 1 BRCA1-interacting protein C-terminal helicase 1 protein protein human Homo sapiens Human MSSMWSEYTIGGVKIYFPYKAYPSQLAMMNSILRGLNSKQHCLLESPTGSGKSLALLCSALAWQQSLSGKPADEGVSEKAEVQLSCCCACHSKDFTNNDMNQGTSRHFNYPSTPPSERNGTSSTCQDSPEKTTLAAKLSAKKQASIYRDENDDFQVEKKRIRPLETTQQIRKRHCFGTEVHNLDAKVDSGKTVKLNSPLEKINSFSPQKPPGHCSRCCCSTKQGNSQESSNTIKKDHTGKSKIPKIYFGTRTHKQIAQITRELRRTAYSGVPMTILSSRDHTCVHPEVVGNFNRNEKCMELLDGKNGKSCYFYHGVHKISDQHTLQTFQGMCKAWDIEELVSLGKKLKACPYYTARELIQDADIIFCPYNYLLDAQIRESMDLNLKEQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSMVNNNIRKKDHEPLRAVCCSLINWLEANAEYLVERDYESACKIWSGNEMLLTLHKMGITTATFPILQGHFSAVLQKEEKISPIYGKEEAREVPVISASTQIMLKGLFMVLDYLFRQNSRFADDYKIAIQQTYSWTNQIDISDKNGLLVLPKNKKRSRQKTAVHVLNFWCLNPAVAFSDINGKVQTIVLTSGTLSPMKSFSSELGVTFTIQLEANHIIKNSQVWVGTIGSGPKGRNLCATFQNTETFEFQDEVGALLLSVCQTVSQGILCFLPSYKLLEKLKERWLSTGLWHNLELVKTVIVEPQGGEKTNFDELLQVYYDAIKYKGEKDGALLVAVCRGKVSEGLDFSDDNARAVITIGIPFPNVKDLQVELKRQYNDHHSKLRGLLPGRQWYEIQAYRALNQALGRCIRHRNDWGALILVDDRFRNNPSRYISGLSKWVRQQIQHHSTFESALESLAEFSKKHQKVLNVSIKDRTNIQDNESTLEVTSLKYSTSPYLLEAASHLSPENFVEDEAKICVQELQCPKIITKNSPLPSSIISRKEKNDPVFLEEAGKAEKIVISRSTSPTFNKQTKRVSWSSFNSLGQYFTGKIPKATPELGSSENSASSPPRFKTEKMESKTVLPFTDKCESSNLTVNTSFGSCPQSETIISSLKIDATLTRKNHSEHPLCSEEALDPDIELSLVSEEDKQSTSNRDFETEAEDESIYFTPELYDPEDTDEEKNDLAETDRGNRLANNSDCILAKDLFEIRTIKEVDSAREVKAEDCIDTKLNGILHIEESKIDDIDGNVKTTWINELELGKTHEIEIKNFKPSPSKNKGMFPGFK DIP protein Q9BX63 original sequence version: 81 8ED691F03A442BE1 rad51_human DNA repair protein RAD51 homolog 1 RAD51 RAD51A RECA RAD51 homolog A protein protein human Homo sapiens Human MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD DIP protein Q06609 original sequence version: 154 DIP protein Q06609 original sequence version: 145 DIP protein Q06609 original sequence version: 122 DIP protein Q06609 original sequence version: 121 DIP protein Q06609 original sequence version: 125 DIP protein Q06609 original sequence version: 123 DIP protein Q06609 original sequence version: 144 DIP protein Q06609 original sequence version: 167 DIP protein Q06609 original sequence version: 169 26578E6206DEDEDA abrx1_human BRCA1-A complex subunit Abraxas 1 ABRAXAS1 ABRA1 CCDC98 Coiled-coil domain-containing protein 98 FAM175A Protein FAM175A UNQ496/PRO1013 protein protein human Homo sapiens Human MEGESTSAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDSQMDDVEVVYTIDIQKYIPCYQLFSFYNSSGEVNEQALKKILSNVKKNVVGWYKFRRHSDQIMTFRERLLHKNLQEHFSNQDLVFLLLTPSIITESCSTHRLEHSLYKPQKGLFHRVPLVVANLGMSEQLGYKTVSGSCMSTGFSRAVQTHSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKRRGAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKNRHVSKSSCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF DIP protein Q6UWZ7 original sequence version: 25 This sequence has been withdrawn from Uniprot. A1ACA4F759BD1AEE uimc1_human BRCA1-A complex subunit RAP80 Retinoid X receptor-interacting protein 110 Receptor-associated protein 80 Ubiquitin interaction motif-containing protein 1 UIMC1 RAP80 RXRIP110 protein protein human Homo sapiens Human MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKCLAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFENVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGIPFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQSVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEKEVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKNEKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLEQSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVTVQPGSRTRTKAGRGRRRKF 56B7699E42395861 ctip_human DNA endonuclease RBBP8 RBBP8 CTIP CtBP-interacting protein Retinoblastoma-binding protein 8 Retinoblastoma-interacting protein and myosin-like Sporulation in the absence of SPO11 protein 2 homolog protein protein human Homo sapiens Human MNISGSSCGSPNSADTSSDFKDLWTKLKECHDREVQGLQVKVTKLKQERILDAQRLEEFFTKNQQLREQQKVLHETIKVLEDRLRAGLCDRCAVTEEHMRKKQQEFENIRQQNLKLITELMNERNTLQEENKKLSEQLQQKIENDQQHQAAELECEEDVIPDSPITAFSFSGVNRLRRKENPHVRYIEQTHTKLEHSVCANEMRKVSKSSTHPQHNPNENEILVADTYDQSQSPMAKAHGTSSYTPDKSSFNLATVVAETLGLGVQEESETQGPMSPLGDELYHCLEGNHKKQPFEESTRNTEDSLRFSDSTSKTPPQEELPTRVSSPVFGATSSIKSGLDLNTSLSPSLLQPGKKKHLKTLPFSNTCISRLEKTRSKSEDSALFTHHSLGSEVNKIIIQSSNKQILINKNISESLGEQNRTEYGKDSNTDKHLEPLKSLGGRTSKRKKTEEESEHEVSCPQASFDKENAFPFPMDNQFSMNGDCVMDKPLDLSDRFSAIQRQEKSQGSETSKNKFRQVTLYEALKTIPKGFSSSRKASDGNCTLPKDSPGEPCSQECIILQPLNKCSPDNKPSLQIKEENAVFKIPLRPRESLETENVLDDIKSAGSHEPIKIQTRSDHGGCELASVLQLNPCRTGKIKSLQNNQDVSFENIQWSIDPGADLSQYKMDVTVIDTKDGSQSKLGGETVDMDCTLVSETVLLKMKKQEQKGEKSSNEERKMNDSLEDMFDRTTHEEYESCLADSFSQAADEEEELSTATKKLHTHGDKQDKVKQKAFVEPYFKGDERETSLQNFPHIEVVRKKEERRKLLGHTCKECEIYYADMPAEEREKKLASCSRHRFRYIPPNTPENFWEVGFPSTQTCMERGYIKEDLDPCPRPKRRQPYNAIFSPKGKEQKT DIP protein Q99708 original sequence version: 111 DIP protein Q99708 original sequence version: 92 DIP protein Q99708-1 original sequence version: 138 DIP protein Q99708 original sequence version: 150 DIP protein Q99708 original sequence version: 110 DIP protein Q99708-1 original sequence version: 110 E028DE56DE55C0F2 brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY DIP protein P38398 original sequence version: 183 DIP protein P38398 original sequence version: 111 DIP protein P38398 original sequence version: 149 DIP protein P38398-1 original sequence version: 149 DIP protein P38398 original sequence version: 142 DIP protein P38398 original sequence version: 212 DIP protein P38398 original sequence version: 163 DIP protein P38398 original sequence version: 185 DIP protein P38398 original sequence version: 148 DIP protein P38398 original sequence version: 210 89C6D83FF56312AF ccdc98-brca1 7 18 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 1 A Synthetic peptides containing pSer406 bound GST-BRCA1-BRCT, whereas the pSer404 and unphosphorylated peptides did not brca1-ccdc98-1 7 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 18 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P38398:p.Met1775Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 15:13:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met1775arg' Tue Jun 30 20:15:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met1775Arg' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1 B, S2 B, C Abraxas specifically bound to the BRCT repeats of wild-type BRCA1 (Fig. 1B), but not a cancer-causing BRCT mutant, M1775R HA-Abraxas does not associate with the BRCT domains of MDC1 or 53BP1. Treatment of the cell lysates with lamda phosphatase abolished this interaction, indicating that only phosphorylates Abraxas interacts with BRCA1. brca1-ccdc98-2 9 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6UWZ7:p.Ser406Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:50:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser406ala' Tue Jun 30 20:15:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Ala' 18 unspecified role unspecified role bait bait physical association physical association 1 C Binding of ABRA1 to BRCA1 requires phosphorylation Q6UWZ7 trnasfection Mutation of Ser406 disrupts the interaction, indicating that phsophorylation of this residue is required for this interaction. brca1-brip1 4 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain association association 1 F A search for additional BRCA1-BRCT-binding proteins that bound to tandem affinity purification (TAP)-tagged BRCA1-BRCT domains (15) identified RAP80 ccdc98-brca1-1 12 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6UWZ7:p.Ser406Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 18:31:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser406ala' Tue Jun 30 17:25:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Ala' 18 unspecified role unspecified role prey prey physical association physical association 1 C Binding of ABRA1 to BRCA1 requires phosphorylation Q6UWZ7 transfection brca1-ccdc98 10 18 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization 3 A This interaction occurred both with IR treatment and without IR treatment. ccdc98-rad51 10 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component colocalization colocalization 3 A Ionizing radiation (IR) - this interaction occurred after treatment with 10 Gy IR followed by 4 hr incubation. brca1-rxrip110-1 10 16 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component colocalization colocalization 3 B Ionizing radiation - IR (10 Gy followed by 2 hr incubation) stimulated this interaction. This interaction occurred both without IR treatment and after IR treatment. rad51-rxrip110 10 16 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization 3 B Ionizing radiation (IR) - this interaction occurred after treatment with 10 Gy IR followed by 4 hr incubation. brca1-ccdc98-4 10 18 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6UWZ7:p.Ser406Ala mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:39:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser406ala' Tue Jun 30 17:15:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Ala' colocalization colocalization 3 C UV - this colocalization occurred after UV laser microirradiation (cells were fixed and stained 15 min after laser treatment). The S406A mutation appears to stimulate the colocalization, as seen in Fig. 3 C. fam175a-bach1 8 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association 4 A This interaction occurs both with IR treatment and without IR treatment. fancj-brca1 8 13 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 4 A This interaction occurred both in the absence of treatment with IR and following IR treatment. rbbp8-brca1 8 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 4 A This interaction occurred both in the absence of treatment with IR and following IR treatment. The bands for BRCA1 are very feint in Fig. 4 A but the authors state that Abraxas binds BRCA1 mutually exclusively with CtIP. brca1-bach1 8 13 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey association association 4 A This interaction occurs both with IR treatment and without IR treatment, although the band for CtIP is feinter after IR. rxrip110-brca1-4 8 15 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association 4 A This interaction occurs both with IR treatment and without IR treatment. rxrip110-ccdc98 2 16 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey physical association physical association 4 B The RAP80-ABRA1 interaction is BRCA1-independent, because the S406A ABRA1 mutant maintained RAP80 binding (fig. S9) and because RAP80-ABRA1 association was intact in HCC1937 cells This interaction is independent of BRCA1 as HCC1937 cells are BRCA1-deficient. ccdc98-rxrip110 2 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 4 B The RAP80-ABRA1 interaction is BRCA1-independent, because the S406A ABRA1 mutant maintained RAP80 binding (fig. S9) and because RAP80-ABRA1 association was intact in HCC1937 cells This interaction is independent of BRCA1 as HCC1937 cells are BRCA1-deficient. rxrip110-ccdc98-1 1 15 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 4 B The RAP80-ABRA1 interaction is BRCA1-independent, because the S406A ABRA1 mutant maintained RAP80 binding (fig. S9) and because RAP80-ABRA1 association was intact in HCC1937 cells ccdc98-rxrip110-1 1 15 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association 4 B The RAP80-ABRA1 interaction is BRCA1-independent, because the S406A ABRA1 mutant maintained RAP80 binding (fig. S9) and because RAP80-ABRA1 association was intact in HCC1937 cells rxrip110-brca1-1 11 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 4 C To determine the extent Abraxas and CtIP mediate RAP80 binding to BRCA1, we immunoprecipitated RAP80 from cells depleted for ABRA1, BACH1, or CtIP. The RAP80-BRCA1 interaction was decreased when ABRA1, but not BACH1 or CtIP, was depleted This interaction was decreased by treatment with siRNA oligos to ABRA1. rxrip110-brca1 3 16 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 4 C To determine the extent Abraxas and CtIP mediate RAP80 binding to BRCA1, we immunoprecipitated RAP80 from cells depleted for ABRA1, BACH1, or CtIP. The RAP80-BRCA1 interaction was decreased when ABRA1, but not BACH1 or CtIP, was depleted Treatment with siRNA oligos to BACH1 did not affect this interaction. rxrip110-brca1-2 5 16 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 4 C To determine the extent Abraxas and CtIP mediate RAP80 binding to BRCA1, we immunoprecipitated RAP80 from cells depleted for ABRA1, BACH1, or CtIP. The RAP80-BRCA1 interaction was decreased when ABRA1, but not BACH1 or CtIP, was depleted Treatment with siRNA oligos to CtIP did not affect this interaction. ccdc98-brca1-2 6 18 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction S2 A Purified GST-Brca1-BRCT fragments bind specifically to phosphorylated Abraxas peptides conjugated on BIAcore chip surfaces. Only Abraxas peptides containing pSer406 bound GST-BRCA1-BRCT. brca1-ccdc98-5 7 18 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ser406ala opser O-phospho-L-serine (2S)-2-amino-3-(phosphonooxy)propanoic acid 2-amino-3-hydroxypropanoic acid 3-phosphate 2-azanyl-3-(phosphonooxy)propanoic acid ACT_SITE Phosphoserine intermediate MOD_RES Phosphoserine O-phospho-L-serine O-phosphonoserine O-phosphorylated L-serine O3-phosphoserine serine phosphate ester OPSer Phospho Phospho Seryl Phosphorylation phosphorylations mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction 1 B, S2 D Abraxas specifically bound to the BRCT repeats of wild-type BRCA1 (Fig. 1B), but not a cancer-causing BRCT mutant, M1775R HA-Abraxas does not associate with the BRCT domains of MDC1 or 53BP1. Treatment of the cell lysates with lamda phosphatase abolished this interaction, indicating that only phosphorylates Abraxas interacts with BRCA1. brca1-rxrip110 7 18 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 16 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. direct interaction direct interaction S5 A, C Rap80 interacts specifically with the Brca1-BRCT domain in vitro. This interaction is phosphorylation-dependent as incubation of lysates with lambda phosphatase abolished the interaction. rxrip110-brca1-3 8 18 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association S5 B, S11 RAP80 from extracts associates with GST-BRCA1-BRCT in vitro and BRCA1 in vivo in a phosphorylation dependent manner Ionizing radiation (IR) - this interaction was stimulated by treatment with 10 Gy IR. Lambda phosphatase - this interaction was abolished by treatment with lamda phosphatase, indicating that the interaction is phsophorylation-dependent. ccdc98-rxrip110-2 12 16 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q6UWZ7:p.Ser406Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:30:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser406ala' Tue Jun 30 16:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser406Ala' physical association physical association S9 The interaction was not affected by treatment with 10 GY IR. Q6UWZ7 transfection ccdc98-rbbp8 12 15 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey physical association physical association S12 CtIP was detected in RAP80 immunoprecipitates Q6UWZ7 transfection