MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Essential role for beta-arrestin 2 in the regulation of Xenopus convergent extension movements. Essential role for beta-arrestin 2 in the regulation of Xenopus convergent extension movements. EMBO J. (0261-4189) 2007 imex curation Kim GH., Han JK. 2009-01-08 Only protein-protein interactions human-293ft Homo sapiens HEK293FT cell line 293ft HEK293FT cell line anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kim GH., Han JK. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation Essential role for beta-arrestin 2 in the regulation of Xenopus convergent extension movements. Essential role for beta-arrestin 2 in the regulation of Xenopus convergent extension movements. EMBO J. (0261-4189) 2007 imex curation Kim GH., Han JK. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Kim GH., Han JK. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation a5j090_xenla protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MGERAGTRVFKKSSPNCKLTVYLGKRDFVDHLDRVDPVDGVVLVDTDYLKDRKVYVTLTCAFRYGREDLDVLGLSFRKDLFISTFQAYPPLPEEKKPLTRLQERLIKKLGEQAHPFYFTIPQNLPCSVTLQPGPEDTGKACGVDYEIRAFCARNMEEKMHKRNSVRLVIRKVQFAPEKPGPQPVAETTRHFLMSNRSLHLEASLDKELYYHGEAINVNVHVTNNSSKTVKRVKVSVRQYADICLFSTAQYKCPVAQIELDDLVAASSTFCKVYTLTPLLSNNREKRGLALDGKLKHEDTNLASSTIVKEGSSKEVLGILVSYRVKVKLVVSRGGDVAVELPFVLMHPKPPENISRPLSEYPQTDVPVDTNLIEFDTNFAQDDDIVFEDFARLRLKGLKDDKDDDEAYC mint BA6367CFF585F81F fzd2_rat Frizzled-2 Fzd2 protein protein rat Rattus norvegicus (Rat) Rat MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPSGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSHHHTRFARLWILTWSVLCCASTFFTVTTSLVAMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVGQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHAAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNRLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEPLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRTSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV mint Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Activation by Wnt5A stimulates PKC activity via a G-protein-dependent mechanism 4FB895D9BEAFCA4E daam1_human Disheveled-associated activator of morphogenesis 1 DAAM1 KIAA0666 protein protein human Homo sapiens Human MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTALRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQSLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTAIMSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRFELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGGMLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSLNKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDLSKLKRNRKRITNQMTDSSRERPITKLNF E82D9892390254B6 dvl2_xenla Segment polarity protein dishevelled homolog DVL-2 dvl2 dsh DSH homolog 2 Xdsh protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAETKVIYHLDEEETPYLVKVPVPATDIRLRDFKAALGRGHAKYFFKAMDQDFGVVKEEISDDNAKLPCFNDRVVSWLASSEGSQPDSAPPAPATEVRPEPPPPVPPPIPPPPAERTSGIGDSRPPSFHPNVSGSTEQLDQDNESVISMRRDRVRRRESSEQAGVGRGVNGRTERHLSGYESSSTLLTSEIETSICDSEEDDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQGYFTLPRNEPIHPIDPAAWVSHSAALSGSFPVYPGSASMSSMTSSTSVTETELSHALPPVSLFSLSVHTDLASVVKVMASPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFQDRREARKFASNLLKAGFIRHTVNKITFSEQCYYIFGDLTGCENYMTNLSLNDNDGSSGASDQDTLAPLPLPGASPWPLLPTFSYQYQAPHPYSTQPPAYHELSSYSYGMGSAGSQHSEGSRSSGSNRSDGGRGMQKDDRSGVAGVGGGDSKSGSGSESEYSTRSSIRRVGGGEAGPPSERSTSSRLPPHHPPSVHSYAAPGVPLSYNPMMLMMMPPPPLPPPGVCPPNSSVPPGAPPLVRDLASVPPELTATRQSFHMAMGNPSEFFVDVM AF6C9A1662DD7CEB q9w760_xenla RhoA protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELTKMKQEPVKPEEGRDMANRISAYAYMECSAKTKDGVREVFELATRAALQARRGKKKPRCLLI mint 591F7F860644E855 defb1_human Beta-defensin 1 Defensin, beta 1 DEFB1 BD1 HBD1 protein protein human Homo sapiens Human MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK mint Has bactericidal activity homomint B0AB76DEC3B14F94 fzd7a_xenla Frizzled-7-A fzd7-a fz7-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSSTVSLLFCCLFLQLCPSAQQYHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDNSPSGPTARPSPYLPDSITFQPHPHRDFTCPRQLKVPPYLAYRFLGEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCCISTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYTAGFLLEERAVCVERFSEDSYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGYAVPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRLSNGSKGETAV DA44954BFF8F594B fzd7_a-a5j090 1 beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Xfz7 9 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3E EMBO-Journal mint fzd2-a5j090 1 Rfz2 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F3E EMBO-Journal mint a5j090-dvl2 1 beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Xdsh 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5A EMBO-Journal mint a5j090-dvl2-1 1 beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Xdsh 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5A EMBO-Journal mint a5j090-dvl2-2 1 beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Xdsh 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain range MINT-4821331: original sequence: 1-82 : MAETKVIYHLDEEETPYLVKVPVPATDIRLRDFKAALGRGHAKYFFKAMDQDFGVVKEEISDDNAKLPCFNDRVVSWLASS ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F5B F5C EMBO-Journal domino mint dvl2-a5j090 1 beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Xdsh 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association EMBO-Journal F6K mint a5j090-daam1 1 beta arrestin 2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DAAM1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F6A EMBO-Journal mint dvl2-daam1 1 Xdsh 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined DAAM1 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association EMBO-Journal F6K mint a5j090-rhoa 1 Xbarr2 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RhoA 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F7A EMBO-Journal mint defb1-rhoa 2 RBD 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RhoA 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F3F EMBO-Journal F4I Overexpression of Xbarr2 increases this interaction. mint