MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The Hansenula polymorpha peroxisomal targeting signal 1 receptor, Pex5p, functions as a tetramer. The Hansenula polymorpha peroxisomal targeting signal 1 receptor, Pex5p, functions as a tetramer. FEBS Lett. (0014-5793) 2007 imex curation Moscicka KB., Klompmaker SH., Wang D., van der Klei IJ., Boekema EJ. 2009-01-08 Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Moscicka KB., Klompmaker SH., Wang D., van der Klei IJ., Boekema EJ. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation The Hansenula polymorpha peroxisomal targeting signal 1 receptor, Pex5p, functions as a tetramer. The Hansenula polymorpha peroxisomal targeting signal 1 receptor, Pex5p, functions as a tetramer. FEBS Lett. (0014-5793) 2007 imex curation Moscicka KB., Klompmaker SH., Wang D., van der Klei IJ., Boekema EJ. 2009-01-08 Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Moscicka KB., Klompmaker SH., Wang D., van der Klei IJ., Boekema EJ. FEBS Lett. (0014-5793) 2007 2009-01-08 Only protein-protein interactions imex curation q3zjz2_pican PEX20 protein protein pican Pichia angusta MSFSNAFGDSCGANNALNKFTQRANVDNSLANQLRANSDSQRLQAQPHQTVDQQLESEYRAFQQQTPSYQASFQTLPTPAFIEENQWVNHFRDMNLHDTPGAQHLQQVPTQSLHSQQWRHEFAQSQQQQQQQETADTYSSAFRMRTGAPQLATSLAPQVVSAATVREDFSAVDAAFDELEHEMHDEKMEEQQAEQVKPQNEDDKIKFAQLARSVFLTMSQPPADISKQTSDKFQKSNFLKLMNRISTREVEMNEDRDRFVDAQGRDIRDMLPDPLKDIKEEGLAGMGPFASAQQVYSQMGDDLRPSMWQ mint FC5BCB0E5F34D386 pex5_pican Peroxisomal targeting signal receptor PEX5 PAH2 PER3 Peroxisomal protein PAH2 Peroxin-5 protein protein pican Pichia angusta MSFLGGSECAANANPLAQFFKQSQHDTSLEQSLRNSAHDTHQNAQIRAPVAMNEAERAHMEQFMNQSTPFNFQPMANELRMIQPDLQTQTTPALRGPRAQNPVPLQIPGQAQPQVSGWSSEFQNTATSQVTHSPSPVSQVRMRSMGMAPRLHLRPFSSANGPIQASSMTNSVMQEDTSQQVDWEQQFKEMEEMEEMEEATAAMQQPAEETVSAQESAFDQVWDNIQETYADNMLSNDEFQAQWEKDFEKYAQTRLNYGEYTFEENNQFRNNLDAYEIGIKLMESGAKLSEAALAFEAAVEQNPGHVDAWLRLGQVQTQNEKELAGIAALEKCLELSPQNLVALMTLAISYINEGYDNAAFATLERWIETKYPEVAERARNANPDIQADDRFSLNKRVTQLFIKAAQLSPEGANMDSEVQTGLGVLFYSMEEYSKTLDCFQAAIEHNPNDALAWNRLGASLANSNKPEQAIEAYSRTLQLNPNFVRARYNLGVSFINMGMYRDAVDHLLTGLSMHEVESLDGSSSVARSNQSTSLIETLKRAFLAMDRRDLIDKVKPGLNVESFRKTYDI Binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import mint A407FC5808C8885A pex5-pex20 1 PEX5 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PEX20 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F2 FEBS-Letters mint pex20-pex5 1 PEX20 3 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PEX5 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association F2 FEBS-Letters mint pex20-pex5-1 2 PEX20 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified PEX5 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction F5 FEBS-Letters mint pex5-1 2 PEX5 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction F4 F5 FEBS-Letters mint